DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34437 and CG4650

DIOPT Version :9

Sequence 1:NP_001097955.1 Gene:CG34437 / 5740179 FlyBaseID:FBgn0085466 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_609722.2 Gene:CG4650 / 34859 FlyBaseID:FBgn0032549 Length:299 Species:Drosophila melanogaster


Alignment Length:266 Identity:78/266 - (29%)
Similarity:119/266 - (44%) Gaps:35/266 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 GSLCFLFTLVLAHQGSAYFLDFEC---VNHKPHQDVFKETPWMAFI--ASPTKNCSGTLINKQYV 63
            |....||.|.:  .||:.:||..|   .|.|...::  .:||||::  :.....|.||:|.::.|
  Fly     7 GISALLFLLPV--PGSSQYLDGRCGLLTNGKIANNI--SSPWMAYLHTSELLYVCGGTVITEKLV 67

  Fly    64 ITTASCVFDQSESTV-----FLGRFDNIPQNRNRYVKHSVQSVYTHKLYNKQTFEHDIALLLLDD 123
            :|.|.|. ..||..|     |:|..|   .|.....::.|...:.|.|||..|..:|||:|.|..
  Fly    68 LTAAHCT-RASEQLVARIGEFIGTDD---ANDTMLSEYQVSQTFIHSLYNTTTSANDIAILGLAT 128

  Fly   124 PVTFKMSIQPIC-----IWLGEITNLNHLESNRWGL----SEKMIFQRINTVKILKIKKCRDSFG 179
            .:.|..:|:|||     ||...|.|:..|...:|||    :|...| ||..::......|....|
  Fly   129 DIVFSKTIRPICIVWWTIWRKYIDNIQVLSGAQWGLPNDRNESDAF-RITDIRRQPANMCSTLNG 192

  Fly   180 ITLKKSQICAGFQNGNIC-TETGSSLVKQIHYSGKLWNTLIGIQSYGVSERC----IYNKIAHYI 239
            ..:..||.|||..:..:| .:..|.|...|.:.......||||.:  .:::|    :|..:..:.
  Fly   193 TAILSSQFCAGDSDSKLCNVDFSSPLGAIITFKNIQRYVLIGIAT--TNQKCKRASVYTDVLSHT 255

  Fly   240 DWIVGV 245
            |:|:.|
  Fly   256 DFILSV 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34437NP_001097955.1 Tryp_SPc 39..242 CDD:214473 65/223 (29%)
Tryp_SPc 39..242 CDD:304450 65/223 (29%)
CG4650NP_609722.2 Tryp_SPc 33..258 CDD:214473 67/233 (29%)
Tryp_SPc 33..258 CDD:304450 67/233 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.