DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34437 and CG5390

DIOPT Version :9

Sequence 1:NP_001097955.1 Gene:CG34437 / 5740179 FlyBaseID:FBgn0085466 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_001285802.1 Gene:CG5390 / 34383 FlyBaseID:FBgn0032213 Length:406 Species:Drosophila melanogaster


Alignment Length:242 Identity:63/242 - (26%)
Similarity:117/242 - (48%) Gaps:44/242 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 FKETPWMAFIASPTKN-----CSGTLINKQYVITTASCVFDQSESTVFL--GRFD-----NIPQN 89
            |.|.|||..|.....|     |.|.||....|:|.|.||.::..|::.:  |.:|     .|.::
  Fly   157 FGEFPWMLAILREEGNLNLYECGGALIAPNVVLTAAHCVHNKQPSSIVVRAGEWDTQTQTEIRRH 221

  Fly    90 RNRYVKHSVQSVYTHKLYNKQTFEHDIALLLLDDPVTFKMSIQPICI-WLGEITNLNHLESNRWG 153
            .:||||   :.:| |:.:||.:..:|:|::||:.|.|.:.:||.:|: .:|:..:.:...:..||
  Fly   222 EDRYVK---EIIY-HEQFNKGSLYNDVAVMLLESPFTLQENIQTVCLPNVGDKFDFDRCYATGWG 282

  Fly   154 LSE-------KMIFQRINTVKILKIKKCRDSFGIT-------LKKSQICAGFQ-NGNICT-ETGS 202
            .::       ::|.:::: :.::..::|..:...|       |..|.||||.: :.:.|. :.||
  Fly   283 KNKFGKDGEYQVILKKVD-MPVVPEQQCETNLRETRLGRHFILHDSFICAGGEKDKDTCKGDGGS 346

  Fly   203 SLVKQIHYSGKLWNTLIGIQSYGVSERC-------IYNKIAHYIDWI 242
            .||..|......:.: .||.::|:.  |       :|..:|....||
  Fly   347 PLVCPIAGQKNRFKS-AGIVAWGIG--CGEVNIPGVYASVAKLRPWI 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34437NP_001097955.1 Tryp_SPc 39..242 CDD:214473 60/238 (25%)
Tryp_SPc 39..242 CDD:304450 60/238 (25%)
CG5390NP_001285802.1 Tryp_SPc 153..391 CDD:238113 63/242 (26%)
Tryp_SPc 153..390 CDD:214473 61/240 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.