DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34437 and CG40160

DIOPT Version :9

Sequence 1:NP_001097955.1 Gene:CG34437 / 5740179 FlyBaseID:FBgn0085466 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_001015212.1 Gene:CG40160 / 3354965 FlyBaseID:FBgn0058160 Length:421 Species:Drosophila melanogaster


Alignment Length:262 Identity:73/262 - (27%)
Similarity:111/262 - (42%) Gaps:57/262 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 LDFECVNHKPHQDVFKETPW-MAFIASPTKN--CSGTLINKQYVITTASCVFDQSES------TV 78
            |||.......::..|.|.|| :|.:.|...:  |:|:||:||.|:|.|.||    ||      ||
  Fly   159 LDFTLSGVSQNEAGFGEFPWTVALLHSGNLSYFCAGSLIHKQVVLTAAHCV----ESLRTGSFTV 219

  Fly    79 FLGRFD-NIPQNRNRYVKHSVQSVYTHKLYNKQTFEHDIALLLLDDPVTFKMSIQPICIWLGEIT 142
            ..|.:| ...:.|..|.:.|||:|..|..||:::..:|.||::|..|||....|..||  |.:..
  Fly   220 RAGEWDTQTMKERLPYQERSVQTVILHPDYNRRSIAYDFALVILSQPVTLDDHINVIC--LPQQD 282

  Fly   143 NL----NHLESNRWGLSE-------KMIFQRINTVKILKIKKCRDSFGIT-------LKKSQICA 189
            ::    |...|..||...       ..:.:|: .:.|::...|:.....|       |.:|.|||
  Fly   283 DIPQPGNTCFSTGWGKDAFGSLGKYSSLMKRV-PLPIVEFNSCQTRLRGTRLGPKFALDRSFICA 346

  Fly   190 GFQNG-NICTETGSS-------LVKQIHYSGKLWNTLIGIQSYGVSERC------IYNKIAHYID 240
            |.|.| :.|...|.:       ..::..|.      ..||.::|:.  |      .|..:|....
  Fly   347 GGQRGIDTCQGDGGAPLACPRGSTRESRYQ------QTGIVAWGIG--CNDEVPAAYANVALVRG 403

  Fly   241 WI 242
            ||
  Fly   404 WI 405

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34437NP_001097955.1 Tryp_SPc 39..242 CDD:214473 67/244 (27%)
Tryp_SPc 39..242 CDD:304450 67/244 (27%)
CG40160NP_001015212.1 Tryp_SPc 166..408 CDD:238113 70/255 (27%)
Tryp_SPc 169..405 CDD:214473 68/250 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.