DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34437 and CG4259

DIOPT Version :9

Sequence 1:NP_001097955.1 Gene:CG34437 / 5740179 FlyBaseID:FBgn0085466 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_001259904.1 Gene:CG4259 / 33385 FlyBaseID:FBgn0031389 Length:270 Species:Drosophila melanogaster


Alignment Length:265 Identity:60/265 - (22%)
Similarity:108/265 - (40%) Gaps:45/265 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 FLFTLVLAHQGSAYFLDFECVNHKPHQDVFKET---------PWMAFIASPTKNC-----SGTLI 58
            ||.||:::...|.||         .:..:.:||         ||:..:.......     .|:||
  Fly     7 FLTTLIISLVNSQYF---------NYNQIRRETYGSNPRATFPWVVSVLDQRDWLFRYIGVGSLI 62

  Fly    59 NKQYVITTASCV--FDQSESTVFLGRFDNIPQNRNRYVKHSVQSVYTHKLYNKQTFEHDIALLLL 121
            |...|:|.|..:  ..:.:..|..|.:|.......::|...|.::.:|:.:|:...|:::|||:|
  Fly    63 NPNVVLTAAHILNGTTKYDLVVRAGEWDTSTTADQQHVDLEVLNIVSHEQFNRFNAENNMALLIL 127

  Fly   122 DDPVTFKMSIQPICIWLGEI-TNLNHLESNRWG---LSEKMIFQRINTVKI--LKIKKCRDSFGI 180
            ........:|..|.::|.|. ........|.||   |:.......:.||::  |.:..|...   
  Fly   128 VSAFEMTANINLIPLYLQEAGIQKGSCFFNGWGKVYLNSTDYPTVLKTVQVDLLSMGMCSSR--- 189

  Fly   181 TLKKSQICAGFQNGNICT-ETGSSLVKQI-HYSGKLWNTLIGIQSYGVSER------CIYNKIAH 237
            .|...|||.....|..|: :.|:.||.:| .|..|.  ..:||.:: :|::      .::..:|.
  Fly   190 KLPIQQICGKGLEGIDCSGDGGAPLVCRILTYPYKY--AQVGIVNW-LSQKPVENTFIVFTNVAG 251

  Fly   238 YIDWI 242
            .:.||
  Fly   252 LLPWI 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34437NP_001097955.1 Tryp_SPc 39..242 CDD:214473 51/232 (22%)
Tryp_SPc 39..242 CDD:304450 51/232 (22%)
CG4259NP_001259904.1 Tryp_SPc 39..259 CDD:238113 51/224 (23%)
Tryp_SPc 39..256 CDD:214473 49/222 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24258
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.