DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34437 and CLIPA14

DIOPT Version :9

Sequence 1:NP_001097955.1 Gene:CG34437 / 5740179 FlyBaseID:FBgn0085466 Length:266 Species:Drosophila melanogaster
Sequence 2:XP_552456.2 Gene:CLIPA14 / 3291432 VectorBaseID:AGAP011788 Length:281 Species:Anopheles gambiae


Alignment Length:126 Identity:36/126 - (28%)
Similarity:59/126 - (46%) Gaps:16/126 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 LDFECVNHKPHQDVFKETPWMAFIASPTK---------NCSGTLINKQYVITTASCVFDQSESTV 78
            :.|.....|..:..:.|.|||..:....:         .|..:||....|:|.|.|||::.:..:
Mosquito   158 IGFRIEGQKDGESEYGEFPWMLAVLREERVADSNLNVYECGASLIAPNVVLTAAHCVFNKQKEQL 222

  Fly    79 FL--GRFDNIPQNRNRYVKHS---VQSVYTHKLYNKQTFEHDIALLLLDDPVTFKMSIQPI 134
            .:  |.:|.  |.||...:|.   |..|.||:.:||.:..:|:|||:|.:|.....::|||
Mosquito   223 LIRAGEWDT--QTRNELYQHQDRRVAEVITHEAFNKASLANDVALLILTEPFQLAENVQPI 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34437NP_001097955.1 Tryp_SPc 39..242 CDD:214473 34/110 (31%)
Tryp_SPc 39..242 CDD:304450 34/110 (31%)
CLIPA14XP_552456.2 Tryp_SPc 169..>281 CDD:304450 32/113 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.