DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34437 and AgaP_AGAP005687

DIOPT Version :9

Sequence 1:NP_001097955.1 Gene:CG34437 / 5740179 FlyBaseID:FBgn0085466 Length:266 Species:Drosophila melanogaster
Sequence 2:XP_556332.3 Gene:AgaP_AGAP005687 / 3290023 VectorBaseID:AGAP005687 Length:297 Species:Anopheles gambiae


Alignment Length:229 Identity:52/229 - (22%)
Similarity:93/229 - (40%) Gaps:54/229 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 TKNCSGTLINKQYVITTASCVFDQSESTV-----FLGRFD----NIPQNRNRYVKHSVQSVYTHK 105
            |..|.|:::.:.:::|.|.||...|.:.|     .:|..:    .:.|.|.|:....::   .|.
Mosquito    82 TALCGGSVLTRNFILTAAHCVSATSTTLVSGGIAIMGAHNRTAMELSQQRIRFTSTGIR---RHP 143

  Fly   106 LYNKQTFEHDIALLLLDDPVTFKMSIQPICIWLGEITNLNHLES-----NRWGLSE-----KMIF 160
            .|:..:..:|:||:||:.|:||...::||.  |...|:....|.     :.:|.|.     ....
Mosquito   144 EYDDTSLRNDVALILLNSPMTFTSRVKPIS--LPARTDTRQFEGFTGTVSGFGRSSDASPYPSSI 206

  Fly   161 QRINTVKILKIKKCRDSFGITLKKSQ-----------ICAGFQNGNICTETGSSLVKQIHYSGKL 214
            .|..:..|:...:|..|:|..|.:||           .|.|...|.:...:|..|          
Mosquito   207 LRFTSNPIMSKAECIVSWGFALAQSQNVCLKPTGGRSSCNGDSGGPLTVNSGGVL---------- 261

  Fly   215 WNTLIGIQSYGVSERC------IYNKIAHYIDWI 242
               .||..|:|.|..|      :|.::::::.||
Mosquito   262 ---QIGTVSFGSSYGCASGWPSVYARVSYFLSWI 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34437NP_001097955.1 Tryp_SPc 39..242 CDD:214473 50/227 (22%)
Tryp_SPc 39..242 CDD:304450 50/227 (22%)
AgaP_AGAP005687XP_556332.3 Tryp_SPc 56..292 CDD:214473 50/227 (22%)
Tryp_SPc 57..295 CDD:238113 52/229 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.