DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34437 and gd

DIOPT Version :9

Sequence 1:NP_001097955.1 Gene:CG34437 / 5740179 FlyBaseID:FBgn0085466 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_001259479.1 Gene:gd / 32159 FlyBaseID:FBgn0000808 Length:531 Species:Drosophila melanogaster


Alignment Length:272 Identity:67/272 - (24%)
Similarity:109/272 - (40%) Gaps:68/272 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 PWMAFI-----ASPTKNCSGTLINKQYVITTASCV------FDQSESTVFLGRFDNIPQNRNRYV 94
            ||:|.|     .|....|.|:|::.:.||::|.|.      :..:|..|||||.:....|....:
  Fly   263 PWLAAIYVNNLTSLDFQCGGSLVSARVVISSAHCFKLFNKRYTSNEVLVFLGRHNLKNWNEEGSL 327

  Fly    95 KHSVQSVYTHKLYNKQ--TFEHDIALLLLDDPVTFKMSIQPICIWLGEITNLNHLESNRWGLSEK 157
            ...|..:|.|..:|.|  :::.|||:::|.|.|.|...|:|.|:|.|. :...::...| |:...
  Fly   328 AAPVDGIYIHPDFNSQLSSYDADIAVIILKDEVRFNTFIRPACLWSGS-SKTEYIVGER-GIVIG 390

  Fly   158 MIFQRINTVKILKI------KKCRDSFGITLKKSQI----------------------CAGFQNG 194
            ..|.|.|..:..|:      ||..|:....:.|:.|                      |||.|..
  Fly   391 WSFDRTNRTRDQKLSSELPGKKSTDASAPKVVKAPIVGNAECFRANAHFRSLSSNRTFCAGIQAE 455

  Fly   195 NICT-ETGSSLVKQIHYSG------KLWNTLIGIQSYGV-----------------SERCIYNKI 235
            ...| ::|:|:...|..:|      ..| .|.|..|..:                 ::..||..:
  Fly   456 ERDTHQSGASIYTGISGAGLFIRRNNRW-MLRGTVSAALPAVETPDAESSHKLCCKNQYIIYADV 519

  Fly   236 AHYIDWIVGVVL 247
            |.::|||...|:
  Fly   520 AKFLDWITAFVI 531

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34437NP_001097955.1 Tryp_SPc 39..242 CDD:214473 64/265 (24%)
Tryp_SPc 39..242 CDD:304450 64/265 (24%)
gdNP_001259479.1 GD_N 27..124 CDD:292649
Tryp_SPc 257..526 CDD:238113 64/265 (24%)
Tryp_SPc 258..526 CDD:214473 64/265 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455965
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24258
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.