DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34437 and Ovch2

DIOPT Version :9

Sequence 1:NP_001097955.1 Gene:CG34437 / 5740179 FlyBaseID:FBgn0085466 Length:266 Species:Drosophila melanogaster
Sequence 2:XP_003749007.2 Gene:Ovch2 / 308919 RGDID:1564636 Length:579 Species:Rattus norvegicus


Alignment Length:239 Identity:61/239 - (25%)
Similarity:112/239 - (46%) Gaps:45/239 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 PWMAFIASPTKN-CSGTLINKQYVITTASCVFDQSES---TVFLGRFDNIPQNRNRYVKHSVQSV 101
            ||...:....|: |.||:|:.|:|||.|.|:.:::.:   .|..|..| :.|........:::::
  Rat    64 PWQVSLKQKQKHICGGTIISSQWVITAAHCMANRNIALTLNVTAGEHD-LSQAEPGEQTLAIETI 127

  Fly   102 YTHKLYN-KQTFEHDIALLLLDDPVTFKMSIQPICI-WLGEITNLNHL-ESNRWG-LSE----KM 158
            ..|..:: |:...:|||||.:.....|...::|:|: ..||..|..:: .:..|| |||    ..
  Rat   128 IIHPQFSTKKPMNYDIALLKMVGTFQFGQFVRPVCLPEPGEQFNAGYICTTAGWGRLSEGGSLPQ 192

  Fly   159 IFQRINTVKILKIKKCRDSFGITLK-----KSQICAGFQNG--NICT-ETGSSLVKQIHYSGKLW 215
            :.|::| :.||..::| ::..:||:     |:.:|.|..:|  :.|. ::|.||:.|.....  |
  Rat   193 VLQQVN-LPILTHEEC-EAVMLTLRNPITGKTFLCTGSPDGGRDACQGDSGGSLMCQNRKGA--W 253

  Fly   216 NTLIGIQSYGVSERC-----------------IYNKIAHYIDWI 242
             ||.|:.|:|:.  |                 |:..:...:.||
  Rat   254 -TLAGVTSWGLG--CGRSWRNNARKKEQGSPGIFTDLRRVLPWI 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34437NP_001097955.1 Tryp_SPc 39..242 CDD:214473 59/237 (25%)
Tryp_SPc 39..242 CDD:304450 59/237 (25%)
Ovch2XP_003749007.2 Tryp_SPc 52..297 CDD:238113 61/239 (26%)
CUB 317..420 CDD:238001
CUB 431..541 CDD:238001
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.