DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34437 and Prss32

DIOPT Version :9

Sequence 1:NP_001097955.1 Gene:CG34437 / 5740179 FlyBaseID:FBgn0085466 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_001100453.1 Gene:Prss32 / 302970 RGDID:1311905 Length:334 Species:Rattus norvegicus


Alignment Length:267 Identity:67/267 - (25%)
Similarity:111/267 - (41%) Gaps:59/267 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 PWMAFIASPTKN-CSGTLINKQYVITTASCVFDQ----SESTVFLGRFDNIPQNRN--------R 92
            ||...:.....: |.|:||::.:|:|.|.| |:|    |..||.||...:.|::..        :
  Rat    66 PWQVSVREDGVHVCGGSLISEDWVLTAAHC-FNQDQHLSAYTVLLGTISSYPEDNEPRELRAVAQ 129

  Fly    93 YVKHSVQSVYTHKLYNKQTFEHDIALLLLDDPVTFKMSIQPICI-------------WLGEITNL 144
            |:|:...|...|.       ..|||||.|..|::|...:.|:|:             |   :|..
  Rat   130 YIKYPSYSAEEHS-------SGDIALLQLASPISFNDYMLPVCLPKPGDPLDPGTMCW---VTGW 184

  Fly   145 NHLESNRWGLSEKMIFQRINTVKILKIKKCR--------DSFGITLKKSQICAGFQNG--NICT- 198
            .::.:|: .|......|.:. |.::..|.|.        .|....:.:..:||||..|  :.|. 
  Rat   185 GNIATNQ-PLPPPFTLQELQ-VPLIDAKTCNTYYQENSVPSTEQVILEDMLCAGFVEGKKDACNG 247

  Fly   199 ETGSSLVKQIHYSGKLWNTLIGIQSYG----VSER-CIYNKIAHYIDWIVGVVLNVDVILLNSSD 258
            ::|..||..::   .:| ...|:.|:|    :|.| .:|..::.||.||...:.|:.....|.|.
  Rat   248 DSGGPLVCDVN---DVW-IQAGVVSWGSDCALSNRPGVYTNVSVYISWIQNTMWNIPTEGKNFSP 308

  Fly   259 SGSDPRL 265
            |.|...|
  Rat   309 SLSSTPL 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34437NP_001097955.1 Tryp_SPc 39..242 CDD:214473 59/242 (24%)
Tryp_SPc 39..242 CDD:304450 59/242 (24%)
Prss32NP_001100453.1 Tryp_SPc 53..292 CDD:214473 59/242 (24%)
Tryp_SPc 54..295 CDD:238113 61/245 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.