DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34437 and Klk13

DIOPT Version :9

Sequence 1:NP_001097955.1 Gene:CG34437 / 5740179 FlyBaseID:FBgn0085466 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_001163876.1 Gene:Klk13 / 292848 RGDID:1309337 Length:276 Species:Rattus norvegicus


Alignment Length:265 Identity:66/265 - (24%)
Similarity:110/265 - (41%) Gaps:65/265 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 GSAYFL--DFECVNHKPHQDVFKETPWM-AFIASPTKNCSGTLINKQYVITTASCVFDQSESTVF 79
            |::.||  .:.|:   ||..     ||. |.:......|.|.|::.::|:|.|.|..|  ..||.
  Rat    32 GTSGFLPGGYTCL---PHSQ-----PWQAALLVRGRLLCGGVLVHPKWVLTAAHCRKD--GYTVH 86

  Fly    80 -----LGRFDNIPQNRN--RYVKHSVQSVY-THKLYNKQTFEHDIALLLLDDPVTFKMSIQPI-- 134
                 |||.:|..|...  |.:.|....|. ||     ...:|||.||.|..||.....::.:  
  Rat    87 LGKHALGRVENGEQAMEVVRSIPHPEYQVSPTH-----LNHDHDIMLLELKSPVQLSNHVRTLQL 146

  Fly   135 ----CIWLGEITNLNHLESNRWGLSEKMIFQRINTVKILKI--------KKCRDSFGITLKKSQI 187
                |:..|....:     :.||.:..   .::|..|.|:.        ::||..:...:..:.:
  Rat   147 SADDCLPTGTCCRV-----SGWGTTTS---PQVNYPKTLQCANIELRSDEECRQVYPGKITANML 203

  Fly   188 CAGFQNG--NICT-ETGSSLVKQIHYSGKLWNTLIGIQSYG------VSERCIYNKIAHYIDWIV 243
            |||.:.|  :.|. ::|..|:    .:|||:    ||.|:|      .:...:|.:::.|:.||.
  Rat   204 CAGTKEGGKDSCEGDSGGPLI----CNGKLY----GIISWGDFPCGQPNRPGVYTRVSKYLRWIQ 260

  Fly   244 GVVLN 248
            |.:.|
  Rat   261 GTIRN 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34437NP_001097955.1 Tryp_SPc 39..242 CDD:214473 56/234 (24%)
Tryp_SPc 39..242 CDD:304450 56/234 (24%)
Klk13NP_001163876.1 Tryp_SPc 39..262 CDD:238113 61/253 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.