DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34437 and Mcpt1

DIOPT Version :9

Sequence 1:NP_001097955.1 Gene:CG34437 / 5740179 FlyBaseID:FBgn0085466 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_058841.1 Gene:Mcpt1 / 29265 RGDID:3062 Length:247 Species:Rattus norvegicus


Alignment Length:290 Identity:73/290 - (25%)
Similarity:107/290 - (36%) Gaps:82/290 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 SLCFLFTLVLAHQGSAYFLDFECVNHKPHQDVFKETPWMAFIASPTK-----NCSGTLINKQYVI 64
            :|.||..|:|.....|..: ...|...||     ..|:||.:...|:     :|.|.||.:|:|:
  Rat     3 ALLFLMALLLPSGAGAEEI-IGGVESIPH-----SRPYMAHLDIITERGLKDSCGGFLITRQFVL 61

  Fly    65 TTASCVFDQSESTVFLGRFDNIPQNRNRYVKHSVQSVYTHKLYNKQTFEHDIALLLLDDPV--TF 127
            |.|.|  ...|.||.||..| :.:......|..|:..:.||.||.....|||.||.|:..|  |.
  Rat    62 TAAHC--RGREITVTLGAHD-VSKREYTQQKIKVEKQFIHKNYNFLPNLHDIMLLKLEKQVELTP 123

  Fly   128 KMSIQP------------ICIWLGEITNLNHLESNRWGLSE---------KMIFQRINTVKILKI 171
            .:.:.|            :|...|            ||.:.         :.:..||...:..||
  Rat   124 AVDVVPLPSPSDFIHPGTLCWTAG------------WGRTGVKDPTSDTLREVALRIMDEEACKI 176

  Fly   172 KKCRDSFGITLKKSQICAGFQNGNICTETGSSLVKQIHYSGKLWNTLI------GIQSYG---VS 227
            .:..|:      ..|:|.|.           |...|..|:|.....|:      ||.|||   .:
  Rat   177 YRHYDN------NFQVCVGL-----------STRLQTAYTGDSGGPLLCAGVVHGIVSYGHPDAT 224

  Fly   228 ERCIYNKIAHYIDWIVGVVLNVDVILLNSS 257
            ...::.:||.|:.||       :.:|..||
  Rat   225 PPAVFTRIAPYVPWI-------NTVLRESS 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34437NP_001097955.1 Tryp_SPc 39..242 CDD:214473 59/239 (25%)
Tryp_SPc 39..242 CDD:304450 59/239 (25%)
Mcpt1NP_058841.1 Tryp_SPc 20..239 CDD:214473 62/256 (24%)
Tryp_SPc 21..242 CDD:238113 64/265 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.