DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34437 and CG18420

DIOPT Version :9

Sequence 1:NP_001097955.1 Gene:CG34437 / 5740179 FlyBaseID:FBgn0085466 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_995715.1 Gene:CG18420 / 2768924 FlyBaseID:FBgn0028866 Length:299 Species:Drosophila melanogaster


Alignment Length:288 Identity:84/288 - (29%)
Similarity:129/288 - (44%) Gaps:52/288 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 SLCFLFTLVLAHQGSAYFLDFECVNHKPHQ----------DVFKETPWMAFIASPTKN--CSGTL 57
            |:..|.| |....||..|||.||....|.:          .|...:|||||:.:.:..  |.|||
  Fly    10 SILLLLT-VFPLLGSTQFLDSECGTRSPLKLGPRIVNGKVAVRNSSPWMAFLHTSSNQFICGGTL 73

  Fly    58 INKQYVITTASCVFDQSESTVFLGRFDNIPQNRNRYVK-----HSVQSVYTHKLYNKQTFEHDIA 117
            |:::.|:|.|.|....:...|.||.:       ||.:|     |.|...:.|:.|:..|..:|||
  Fly    74 ISRRLVLTAAHCFIPNTTIVVRLGEY-------NRKLKGYREEHQVNRTFQHRFYDPNTHANDIA 131

  Fly   118 LLLLDDPVTFKMSIQPICI-----WLGEITNLNHLESNRWGLSEKM-IFQRINTVKILK--IKKC 174
            ||.|...|.:|.:|:||||     |...|.::..|....||.:|.| ....:.|:.|.:  .|.|
  Fly   132 LLRLVSNVVYKANIRPICIMWDASWKHHIDSIKVLTGTGWGRTESMHDSSELRTLDISRQPSKMC 196

  Fly   175 RDSFGITLKKSQICAGFQNGNICT-ETGSSLVKQIHYSGKLWNTLIGIQSYGVSERC----IYNK 234
              :||..| .:|.|||..|.|:|. :||..:...:.|........:||..  .::||    ::..
  Fly   197 --AFGSVL-SNQFCAGNWNSNLCIGDTGGPVGAMVRYRNAFRFVQVGIAI--TNKRCQRPSVFTD 256

  Fly   235 IAHYIDWIVGVVLNVDVILLNSSDSGSD 262
            :..:|::|..:.|         :.:|:|
  Fly   257 VMSHIEFIRRIFL---------TQNGND 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34437NP_001097955.1 Tryp_SPc 39..242 CDD:214473 67/222 (30%)
Tryp_SPc 39..242 CDD:304450 67/222 (30%)
CG18420NP_995715.1 Tryp_SPc 42..264 CDD:214473 68/233 (29%)
Tryp_SPc 43..267 CDD:238113 69/235 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.