DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34437 and CG33226

DIOPT Version :9

Sequence 1:NP_001097955.1 Gene:CG34437 / 5740179 FlyBaseID:FBgn0085466 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_995917.3 Gene:CG33226 / 2768859 FlyBaseID:FBgn0069056 Length:292 Species:Drosophila melanogaster


Alignment Length:282 Identity:75/282 - (26%)
Similarity:113/282 - (40%) Gaps:47/282 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LCFLFTLVLAHQGSAYFLDFECVNHKP----------HQDVFKETPWMAFIASPTKN-CSGTLIN 59
            :||:..|..........||..|| ..|          |....|..|||..|.....: |.|:||:
  Fly    15 VCFILALRSYESLGQDLLDPNCV-QTPVGVREQILGGHNADIKLHPWMVQILQRGYHFCGGSLIS 78

  Fly    60 KQYVITTASCVFDQSESTVFLGRFDNIPQNRNRYVKHS-----------VQSVYTHKLYNKQTFE 113
            ..:|:|.|.| ..:....|..||:..|..   ||:..|           |:.::.|..| :....
  Fly    79 SLFVLTAAHC-HSRYRLKVRFGRYSGITP---RYLCSSQYCSPFGPEIDVKRIFLHSSY-RDYHN 138

  Fly   114 HDIALLLLDDPVTFKMSIQPICIWLGEITNLNHLES----------NRWGLSEKMIFQRI-NTVK 167
            :||||.||..||.:.:..:|||:.  :.:|.:.|..          ..||.:|..:...| .|..
  Fly   139 YDIALFLLAKPVRYNVQTRPICVL--QTSNKDKLRQFLNYVAMFNVTGWGKTESQLTSTILQTTS 201

  Fly   168 ILKI--KKCRDSFGITLKKSQICAGFQNGNICT-ETGSSLVKQIHYSGKLWNTLIGIQSYGV--- 226
            :..:  |.|...|...:....||||....:.|| ::|..|..::.:||.....|.||.|||.   
  Fly   202 LFHLDRKFCAQIFDRKIGWPHICAGHSQSSTCTGDSGGPLSAELTFSGVKRTVLFGIISYGAPNC 266

  Fly   227 SERCIYNKIAHYIDWIVGVVLN 248
            .|..::..:..|.:||..:|.|
  Fly   267 REVTVFTNVLRYSNWIRDIVHN 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34437NP_001097955.1 Tryp_SPc 39..242 CDD:214473 61/231 (26%)
Tryp_SPc 39..242 CDD:304450 61/231 (26%)
CG33226NP_995917.3 Tryp_SPc 47..285 CDD:238113 65/244 (27%)
Tryp_SPc 47..282 CDD:214473 63/241 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.