DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34437 and CG33458

DIOPT Version :9

Sequence 1:NP_001097955.1 Gene:CG34437 / 5740179 FlyBaseID:FBgn0085466 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_995854.2 Gene:CG33458 / 2768846 FlyBaseID:FBgn0053458 Length:281 Species:Drosophila melanogaster


Alignment Length:278 Identity:71/278 - (25%)
Similarity:117/278 - (42%) Gaps:58/278 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LFTLVLAH---QGSAYFLDFECVNHKPHQDVFKET--------------PWMAFIASPTK-NCSG 55
            |..|:|.|   .|.:|.|:::|       .:.|.|              ||:|::...:| .|.|
  Fly     8 LALLILGHGISLGYSYLLEWDC-------GISKYTYRITGGRDSPLMLNPWLAYLHINSKFICGG 65

  Fly    56 TLINKQYVITTASCVFDQSEST-VFLGRFD---NIPQNRNR----YVKHSVQSVYTHKLYNKQTF 112
            :|:|..:|:|.|.|..|::... |.||..|   .|..|.:.    ::::.:.....|.||....:
  Fly    66 SLLNHWFVLTAAHCFRDKNAKVLVRLGENDASQKIDCNESECAAPHLEYMIMQKLIHPLYRTAHY 130

  Fly   113 EHDIALLLLDDPVTFKMSIQPICI-----WLGEITNLNHLESNRWG------LSEKMIFQRINTV 166
             :||||..|:..|.:..||:|||:     |...:..:.:.....||      :|:|:...||..:
  Fly   131 -YDIALAKLNRYVVYTDSIRPICLMLNPNWQVYVDTIRYFIITGWGATNASEVSDKLQLTRIPQI 194

  Fly   167 KILKIKKCRDSFGITLKKSQICAGFQNGNICT-ETGSSLVKQIHYSGKLWNTLIGIQS------Y 224
            ...   .||..||..:.::.||||.....:.. ::|..|...:.|.........||.|      :
  Fly   195 DRF---TCRYWFGYMVDRTHICAGESKHYVGKGDSGGPLGSMVDYKYAKRFFQFGIVSHLRQPFH 256

  Fly   225 GVSERCIYNKIAHYIDWI 242
            |||   ::..|..|.:||
  Fly   257 GVS---VFTNILSYSNWI 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34437NP_001097955.1 Tryp_SPc 39..242 CDD:214473 60/243 (25%)
Tryp_SPc 39..242 CDD:304450 60/243 (25%)
CG33458NP_995854.2 Tryp_SPc 37..271 CDD:214473 59/240 (25%)
Tryp_SPc 38..274 CDD:238113 61/241 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.