DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34437 and CG33461

DIOPT Version :9

Sequence 1:NP_001097955.1 Gene:CG34437 / 5740179 FlyBaseID:FBgn0085466 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_995843.3 Gene:CG33461 / 2768840 FlyBaseID:FBgn0053461 Length:287 Species:Drosophila melanogaster


Alignment Length:277 Identity:77/277 - (27%)
Similarity:126/277 - (45%) Gaps:40/277 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LCFLFTLVL-AHQGSAYFLDFEC----------VNHKPHQDVFKETPWMAFIASPTK-NCSGTLI 58
            :.:|...|| .|..|:.||:..|          :|..|.:  ....|||||:.:||. .|:|:||
  Fly    10 IAYLALFVLGVHGSSSVFLEENCGVVPRLSYKIINGTPAR--LGRYPWMAFLHTPTYFLCAGSLI 72

  Fly    59 NKQYVITTASCVFDQSESTVFLG---RFDNIPQNRNRYV----KHSVQSVYTHKLYNKQTFEHDI 116
            |:.:|:|:|.|:.|..|....||   |.::|....||.:    :::|..::.|:||:.:.|.:||
  Fly    73 NQWFVLTSAHCIEDDVELIARLGENNRDNDIDCENNRCLEATQEYNVDMLFKHRLYDPKDFSNDI 137

  Fly   117 ALLLLDDPVTFKMSIQPICIWLGE-----ITNLNHLESNRWGLS-------EKMIFQRINTVKIL 169
            .:|.|:..|.:...||||||:...     :..:...::..|||:       ...:...:|..:..
  Fly   138 GMLRLERRVEYTYHIQPICIFHHRRMQLVVDQITWFKATGWGLTSTDLNTKSSRVLMELNLYRRP 202

  Fly   170 KIKKCRDSFGITLKKSQICAGFQNGNICT-ETGSSLVKQIHYSGKLWNTLIGIQSYGVSERC--- 230
            : ..|...|.......|||||..:||:|. ::|....:.:...|......:||.|: ..|.|   
  Fly   203 R-NDCARIFKQNFLSGQICAGNDDGNLCRGDSGGPQGRYVLIFGMKRFVQMGIASF-TYENCSKV 265

  Fly   231 -IYNKIAHYIDWIVGVV 246
             |...:..|..||..||
  Fly   266 SILTDVVRYGRWIKKVV 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34437NP_001097955.1 Tryp_SPc 39..242 CDD:214473 63/227 (28%)
Tryp_SPc 39..242 CDD:304450 63/227 (28%)
CG33461NP_995843.3 Tryp_SPc 41..278 CDD:214473 65/240 (27%)
Tryp_SPc 42..281 CDD:238113 67/242 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.