DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34437 and Sp212

DIOPT Version :9

Sequence 1:NP_001097955.1 Gene:CG34437 / 5740179 FlyBaseID:FBgn0085466 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_996209.2 Gene:Sp212 / 2768666 FlyBaseID:FBgn0053329 Length:516 Species:Drosophila melanogaster


Alignment Length:234 Identity:64/234 - (27%)
Similarity:106/234 - (45%) Gaps:48/234 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 KETPWMAFIASPTKNCSGTLINKQYVITTASCVFDQSESTVF--LGRFDNIPQNRNRYVKHSVQS 100
            ||...:||      .|.|:||:...||:.|.||...:|..|.  |||:|......:.....:|..
  Fly   297 KEVRALAF------KCRGSLISSSIVISAAHCVHRMTEDRVVVGLGRYDLDDYGEDGAEMRNVMR 355

  Fly   101 VYTHKLYNKQTF-EHDIALLLLDDPVTFKMSIQPICIWLGEITNLNHLESNR----------WGL 154
            :..|..||.::: :.||||:.::.||||...|.|||:|.        :|::|          ||.
  Fly   356 LLWHPDYNTRSYSDADIALITIERPVTFNDIIAPICMWT--------VEASRTVSTTGFIAGWGR 412

  Fly   155 SE---KMIFQRINTVKILKIKKCRDSF-GITLKKSQICAGFQNGN---ICTETGSSLVKQIHYSG 212
            .|   :..:.|:...:|.....|..:: |..:.:..:|||.::|:   :....|..:|||    |
  Fly   413 DEDSSRTQYPRVVEAEIASPTVCASTWRGTMVTERSLCAGNRDGSGPCVGDSGGGLMVKQ----G 473

  Fly   213 KLWNTLIGIQSYG---------VSERCIYNKIAHYIDWI 242
            ..| .|.||.|.|         :::..:|..::.:|:||
  Fly   474 DRW-LLRGIVSAGERGPAGTCQLNQYVLYCDLSKHINWI 511

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34437NP_001097955.1 Tryp_SPc 39..242 CDD:214473 61/231 (26%)
Tryp_SPc 39..242 CDD:304450 61/231 (26%)
Sp212NP_996209.2 GD_N 23..122 CDD:292649
Tryp_SPc 277..514 CDD:238113 64/234 (27%)
Tryp_SPc 277..511 CDD:214473 62/232 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24258
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.