DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34437 and Prss43

DIOPT Version :9

Sequence 1:NP_001097955.1 Gene:CG34437 / 5740179 FlyBaseID:FBgn0085466 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_955765.1 Gene:Prss43 / 272643 MGIID:2684822 Length:382 Species:Mus musculus


Alignment Length:258 Identity:71/258 - (27%)
Similarity:119/258 - (46%) Gaps:55/258 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 KETPWMAFIASPTKN-CSGTLINKQYVITTASCVFDQSESTVFLGRFDNIPQNRNRYVK-HSVQS 100
            ::.||...:.|..:: |.|:||:.::|:|.|.|:::|.|..|.||  |::..:.:..|. ..||.
Mouse   128 RKWPWQVSLQSQNEHVCGGSLISHRWVLTAAHCIYEQEEYMVMLG--DDMLHSESESVTLVPVQD 190

  Fly   101 VYTHKLYNKQTFEHDIALLLLDDPVTFKMSIQPICI-------------WLGEITNLNHLESNRW 152
            :.....::.||..:||||.||..||.:...|||:|:             |:......|.:::   
Mouse   191 IIFPSNFDIQTMRNDIALALLYFPVNYSSLIQPVCLPEEPFRVKNGTVCWVTGWGQQNEIDA--- 252

  Fly   153 GLSEKMIFQRINTVKILKIKKCRDSFGITLK-------KSQICAGFQNG--NIC-TETGSSLVKQ 207
            |.: .::.|.:.. :||..|.|...|...|.       |..|| |.|:.  ::| .::|:.||.:
Mouse   253 GFA-SILLQEVQQ-RILLQKHCNTLFQRQLGTSKNLVIKGMIC-GLQDSGQSLCWGDSGNPLVCE 314

  Fly   208 IHYSGKLWNTLIGIQSYGVSERC-------IYNKIAHYIDWIVGVVLNVDVILLNSSDSGSDP 263
               |...| |.:||.|:|::  |       :|..||.|.:|:..|:         |..|..||
Mouse   315 ---SDNTW-TQVGIMSWGIN--CNGVPVLSVYTDIAEYNEWVSYVL---------SQASRMDP 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34437NP_001097955.1 Tryp_SPc 39..242 CDD:214473 65/234 (28%)
Tryp_SPc 39..242 CDD:304450 65/234 (28%)
Prss43NP_955765.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 30..97
Tryp_SPc 117..351 CDD:238113 66/236 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.