DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34437 and Prss45

DIOPT Version :9

Sequence 1:NP_001097955.1 Gene:CG34437 / 5740179 FlyBaseID:FBgn0085466 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_694812.1 Gene:Prss45 / 260408 MGIID:3605764 Length:317 Species:Mus musculus


Alignment Length:239 Identity:63/239 - (26%)
Similarity:95/239 - (39%) Gaps:51/239 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 PWMAFIASPTKN-CSGTLINKQYVITTASCVFDQSESTVFLGRFDNIPQNRNRYVKHSVQSVYTH 104
            ||.|.:....|: |.|.||::.:|::.|.|:....|.:|.||.....|...:..:|..|..:..|
Mouse    62 PWEASLQIEDKHVCGGALIDRSWVVSAAHCIQGNKEYSVMLGSSTLHPNGSSWTLKIPVGDIIIH 126

  Fly   105 -KLYNKQTFEHDIALLLLDDPVTFKMSIQPICIWLGEITNLNHLESNR-----WG---------- 153
             |.:.:.....|||||.|:.||||...:||||:   ...|.|.....:     ||          
Mouse   127 PKYWGRNFIRSDIALLCLETPVTFNKYVQPICL---PEHNFNFKVGTKCWVTGWGQVKQHSSAQL 188

  Fly   154 -----LSEKMIFQRINTVKILKIKKCRDSFG---------ITLKKSQICAGFQNGNIC-TETGSS 203
                 |.|..:|       |:..|.|...|.         ..::|:.||......::| .:.|..
Mouse   189 TPAPELWEAEVF-------IIDNKNCDSIFHKKTLYPQVVPLIRKNMICTTNYGEDLCYGDPGGP 246

  Fly   204 LVKQIHYSGKLWNTLIGIQSY-----GVSERCIYNKIAHYIDWI 242
            |..:|  .|: | .|.|:.|:     .|....:|.:|..|..||
Mouse   247 LACEI--DGR-W-ILAGVFSWEKACATVPNLSVYTRITKYTIWI 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34437NP_001097955.1 Tryp_SPc 39..242 CDD:214473 61/237 (26%)
Tryp_SPc 39..242 CDD:304450 61/237 (26%)
Prss45NP_694812.1 Tryp_SPc 59..289 CDD:238113 63/239 (26%)
Tryp_SPc 59..286 CDD:214473 61/237 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.