DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34437 and CG30289

DIOPT Version :9

Sequence 1:NP_001097955.1 Gene:CG34437 / 5740179 FlyBaseID:FBgn0085466 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_726081.1 Gene:CG30289 / 246532 FlyBaseID:FBgn0050289 Length:316 Species:Drosophila melanogaster


Alignment Length:258 Identity:79/258 - (30%)
Similarity:123/258 - (47%) Gaps:44/258 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 KETPWMAFIASPTKNCSGTLINKQYVITTASCV-FDQSESTVFLGRF---DNIPQNRN-----RY 93
            :|.|||..:.| :|.|.|:||.:|:|:|.|.|| |:  :..|.||.:   |.:|...|     ::
  Fly    51 QENPWMVLVWS-SKPCGGSLIARQFVLTAAHCVSFE--DLYVRLGDYETLDPMPYCLNNHCIPKF 112

  Fly    94 VKHSVQSVYTHKLYNKQTFEHDIALLLLDDPVTFKMSIQPICIWLGE-ITNLNHLESNRWGLSEK 157
            ...||.....|:.||..|.::|||||.:.:.|.:...::|||:.:|| :.::.......||.:|.
  Fly   113 YNISVDMKIVHENYNGITLQNDIALLRMSEAVEYSDYVRPICLLVGEQMQSIPMFTVTGWGETEY 177

  Fly   158 MIFQRI---NTVKILKIKKCRDSFGITLKKSQICAGFQNGNICT-ETGSSLVKQIHYSGKLWNTL 218
            ..|.||   .|:..:.|..|...|.....:||||||....|.|. ::|..|..:.||..:|.:..
  Fly   178 GQFSRILLNATLYNMDISYCNIKFNKQADRSQICAGSHTSNTCKGDSGGPLSSKFHYGNRLLSFQ 242

  Fly   219 IGIQSYGVSERC------IYNKIAHYIDWI--------------------VGVVLNVDVILLN 255
            .|:.||| ||||      :|..::::.:||                    ||...|:..|:.|
  Fly   243 YGLVSYG-SERCAANVAGVYTNVSYHREWIFNKMVQFKPTGHTTFWLSKLVGQTCNITDIIRN 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34437NP_001097955.1 Tryp_SPc 39..242 CDD:214473 72/222 (32%)
Tryp_SPc 39..242 CDD:304450 72/222 (32%)
CG30289NP_726081.1 Tryp_SPc 42..271 CDD:214473 72/223 (32%)
Tryp_SPc 42..271 CDD:238113 72/223 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.