DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34437 and CG30288

DIOPT Version :9

Sequence 1:NP_001097955.1 Gene:CG34437 / 5740179 FlyBaseID:FBgn0085466 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_001097398.1 Gene:CG30288 / 246531 FlyBaseID:FBgn0050288 Length:282 Species:Drosophila melanogaster


Alignment Length:238 Identity:63/238 - (26%)
Similarity:101/238 - (42%) Gaps:40/238 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 KETPWMAFIASPTKN-CSGTLINKQYVITTASCVFDQSESTVFLGRFDNIPQNRNRYVKHSV--- 98
            :..|||..:....|. |.|:||..::|:|...|: ......|.||.:|         .:|.:   
  Fly    52 ESNPWMVRVMISGKAVCGGSLITARFVLTAEHCI-SPMYMNVRLGEYD---------TRHPIFDC 106

  Fly    99 -QSVYTHKLYNKQTFE--------HDIALLLLDDPVTFKMSIQPICIWLGEITNLNHLESNR--- 151
             ..|.|.:.||.....        :||.||.:...|.|...::|||:.||:....|.|...|   
  Fly   107 DDFVCTPRAYNVDVDRKIVHSNPGYDIGLLRMQRSVIFSNYVRPICLILGKTLGGNPLSILRFNF 171

  Fly   152 --WGL-SEKMIFQRINTVKILKIKK--CRDSFGITLKKSQICAGFQNGNICT-ETGS--SLVKQI 208
              ||. |:.....|:.|..:.::.:  | :..|..|..|.||||....:.|. ::|.  |.::..
  Fly   172 TGWGTNSDGEEQDRLQTATLQQLPQWSC-ERPGRPLDISYICAGSYISDSCKGDSGGPLSAIRTF 235

  Fly   209 HYSGKLWNTLIGIQSYGV---SERCIYNKIAHYIDWIVGVVLN 248
            ...|:::.  .|:.|.|:   |...||..:.|:.|||:.|:.|
  Fly   236 EGQGRVFQ--FGVASQGLRLCSGLGIYTNVTHFTDWILDVIQN 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34437NP_001097955.1 Tryp_SPc 39..242 CDD:214473 59/229 (26%)
Tryp_SPc 39..242 CDD:304450 59/229 (26%)
CG30288NP_001097398.1 Tryp_SPc 42..270 CDD:214473 59/230 (26%)
Tryp_SPc 45..270 CDD:238113 59/230 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.