DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34437 and CG30098

DIOPT Version :9

Sequence 1:NP_001097955.1 Gene:CG34437 / 5740179 FlyBaseID:FBgn0085466 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_725573.2 Gene:CG30098 / 246456 FlyBaseID:FBgn0050098 Length:264 Species:Drosophila melanogaster


Alignment Length:276 Identity:66/276 - (23%)
Similarity:111/276 - (40%) Gaps:57/276 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LCFLFTLVLAHQGSAYFLDFECVNHKPHQDVF----------KETPWMAFIASPTK-NCSGTLIN 59
            |.||..|.|...|.:..||.:|:      .:|          :.|||||::....: .|.|:||.
  Fly     8 LTFLVILTLGSYGYSQLLDSKCI------ALFRIRVIGGQNARRTPWMAYLIRDNRFACGGSLIA 66

  Fly    60 KQYVITTASCVFDQSESTVFLGRFDNIPQNRNRYVKHSVQSVYTHKLY----NKQTFEHDIALLL 120
            .::|:|.|.|........|.||.:|:......:...:.|.|:|.||.|    |     ||||:|.
  Fly    67 YRFVLTAAHCTKINDNLFVRLGEYDSSRTTDGQTRSYRVVSIYRHKNYIDFRN-----HDIAVLK 126

  Fly   121 LDDPVTFKMSIQPICIWLGE-----ITNLNHLESNRWGLSEKMIFQRINTVKILKIKKCRDSFGI 180
            ||..|.:...|:||||.|..     ..::.:.....|| .....::...|::.:.:::.|:.:  
  Fly   127 LDRQVVYDAYIRPICILLNSGLQSLANSIQNFTLTGWG-QMAHYYKMPTTLQEMSLRRVRNEY-- 188

  Fly   181 TLKKSQICAGFQNGNICT----------ETGSSLVKQIHYSGKLWNTLIGIQSYGVSERC----I 231
                    .|..:.:||.          ::|..|...:.|..|......|:.: .|:..|    .
  Fly   189 --------CGVPSLSICCWNPVQYACFGDSGGPLGSLVKYGHKTIYVQFGVTN-SVTGNCDGYSS 244

  Fly   232 YNKIAHYIDWIVGVVL 247
            |..:..|:.|:...:|
  Fly   245 YLDLMSYMPWLYQTLL 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34437NP_001097955.1 Tryp_SPc 39..242 CDD:214473 54/226 (24%)
Tryp_SPc 39..242 CDD:304450 54/226 (24%)
CG30098NP_725573.2 Tryp_SPc 36..254 CDD:214473 54/234 (23%)
Tryp_SPc 37..258 CDD:238113 55/237 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.