DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34437 and CG30091

DIOPT Version :9

Sequence 1:NP_001097955.1 Gene:CG34437 / 5740179 FlyBaseID:FBgn0085466 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_725484.1 Gene:CG30091 / 246449 FlyBaseID:FBgn0050091 Length:526 Species:Drosophila melanogaster


Alignment Length:307 Identity:87/307 - (28%)
Similarity:141/307 - (45%) Gaps:56/307 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LFTLVL-AHQGSAYFLDFECVNHKPHQDVFK----------ETPWMAFIASPTK-NCSGTLINKQ 61
            ||..:| |.:|||..||.:|  ..|.|.:.|          :.||||.|.:..: .|.|::|..:
  Fly     8 LFAWMLTAGRGSARLLDEDC--GVPMQLIPKIVGGVDAGELKNPWMALIKTNDEFICGGSVITNK 70

  Fly    62 YVITTA-------SCVFDQSESTVFLGRFDNIP--QNRNRYVKHSVQSVYTHKLYNKQTFEHDIA 117
            :|:|.|       .|:...::.||.||.:..:.  ::.:.:..::|:.||.|..:..|.:.:|||
  Fly    71 FVLTAAHCMCTDEECIVKYTQLTVTLGVYHLLATGEHNHPHEIYNVERVYIHDSFAIQNYRNDIA 135

  Fly   118 LLLLDDPVTFKMSIQPICIWLGEITN-----LNHLESNRWGLS-EKMIFQRINTVKILKI--KKC 174
            ||.|...:.:|..|:|:||.|.:...     :....:..||:: ...:...:..|||.:|  |.|
  Fly   136 LLRLQKSIVYKPQIKPLCILLNDQLKPQTDLIQEFTAIGWGVTGNGKMSNNLQMVKIYRIDRKMC 200

  Fly   175 RDSFGITLKKSQICAGFQNG-NIC-TETGSSLVKQIHYSGKLWNTLIGIQSYGVSERC----IYN 233
            ..:|..|......|||...| :.| .::|..|...:.:.|....|.:||.|.| :|.|    :|.
  Fly   201 EAAFWYTFDYPMFCAGTAVGRDTCKRDSGGPLYIHMLFDGIKRATQLGIVSTG-TEDCRGFGMYT 264

  Fly   234 KIAHYIDWIVGVVLNVD--VIL---------------LNSSD-SGSD 262
            .:..:||:|..:||:.|  |:|               |||.| ||.|
  Fly   265 DVMGHIDFIERIVLDADIEVVLPYIDLLDAGCLGNDTLNSWDRSGPD 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34437NP_001097955.1 Tryp_SPc 39..242 CDD:214473 61/226 (27%)
Tryp_SPc 39..242 CDD:304450 61/226 (27%)
CG30091NP_725484.1 Tryp_SPc 36..273 CDD:214473 62/237 (26%)
Tryp_SPc 37..276 CDD:238113 62/239 (26%)
Trypsin 310..520 CDD:278516 1/2 (50%)
Tryp_SPc 313..520 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.