DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34437 and CG30087

DIOPT Version :9

Sequence 1:NP_001097955.1 Gene:CG34437 / 5740179 FlyBaseID:FBgn0085466 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_725489.2 Gene:CG30087 / 246446 FlyBaseID:FBgn0050087 Length:277 Species:Drosophila melanogaster


Alignment Length:269 Identity:75/269 - (27%)
Similarity:126/269 - (46%) Gaps:40/269 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 FLFTLVLAHQG---SAYFLDFEC------------VNHKPHQDVFKETPWMAFIASPT-KNCSGT 56
            |:..:.|..|.   .|.||:..|            ||.|  :.|.:..|:|.::.:.: .:|.|:
  Fly     8 FVIAICLIRQQRIVDAQFLNPLCGVTYESQTAMRVVNGK--EAVIRSAPFMVYVTNNSLTHCGGS 70

  Fly    57 LINKQYVITTASCVFDQ-----SESTVFLGRFDNIPQNRN---RYVKHSVQSVYTHKLYNKQTFE 113
            ::|.:|::|.|.|||..     .|..:   |.|...|..|   |..::.:....||:.||.....
  Fly    71 ILNSRYILTAAHCVFPNLRLRLGEHNI---RTDPDCQGSNCSPRSEEYGIMKAITHRFYNAANHV 132

  Fly   114 HDIALLLLDDPVTFKMSIQPICIWLGEIT--NLNHLESNRWGLSEKMIFQRINTVKILK---IKK 173
            :|||||.|:..:.|.:.||||||.|...:  ::...::..||.::|..|..:.....|:   ...
  Fly   133 NDIALLKLNRSINFNVHIQPICILLNPASAPSVATYQTFGWGETKKNGFPHLLQTAELRAYDAAY 197

  Fly   174 CRDSFGITLKKSQICAGFQNGNICT-ETGSSLVKQIHYSGKLWNTLIGIQSYGVSERC----IYN 233
            |..||...:..:|||||.:..:.|. ::|..||.::.:.|......:||.|||.:: |    :|.
  Fly   198 CSRSFHAYMNGNQICAGHEERDTCAGDSGGPLVTRVDFDGVKRYLQLGIVSYGPTD-CQSPGVYT 261

  Fly   234 KIAHYIDWI 242
            .:.:||:||
  Fly   262 YVPNYINWI 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34437NP_001097955.1 Tryp_SPc 39..242 CDD:214473 62/221 (28%)
Tryp_SPc 39..242 CDD:304450 62/221 (28%)
CG30087NP_725489.2 Tryp_SPc 41..270 CDD:214473 66/234 (28%)
Tryp_SPc 42..272 CDD:238113 68/235 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.