DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34437 and F7

DIOPT Version :9

Sequence 1:NP_001097955.1 Gene:CG34437 / 5740179 FlyBaseID:FBgn0085466 Length:266 Species:Drosophila melanogaster
Sequence 2:XP_011535776.2 Gene:F7 / 2155 HGNCID:3544 Length:495 Species:Homo sapiens


Alignment Length:238 Identity:68/238 - (28%)
Similarity:100/238 - (42%) Gaps:47/238 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 ETPW-MAFIASPTKNCSGTLINKQYVITTASCVFDQSES----TVFLGRFDNIPQNRNRYVKHSV 98
            |.|| :..:.:..:.|.|||||..:|::.|.| ||:.::    ...||..| :.::........|
Human   252 ECPWQVLLLVNGAQLCGGTLINTIWVVSAAHC-FDKIKNWRNLIAVLGEHD-LSEHDGDEQSRRV 314

  Fly    99 QSVYTHKLYNKQTFEHDIALLLLDDPVTFKMSIQPICIWLGEITNLNHLESNR------------ 151
            ..|.....|...|..||||||.|..||.....:.|:|  |.|.|     .|.|            
Human   315 AQVIIPSTYVPGTTNHDIALLRLHQPVVLTDHVVPLC--LPERT-----FSERTLAFVRFSLVSG 372

  Fly   152 WG--------LSEKMIFQ--RINTVKIL-KIKKCRDSFGITLKKSQICAGFQNGNICTETG-SSL 204
            ||        ..|.|:..  |:.|...| :.:|..||..||  :...|||:.:|:..:..| |..
Human   373 WGQLLDRGATALELMVLNVPRLMTQDCLQQSRKVGDSPNIT--EYMFCAGYSDGSKDSCKGDSGG 435

  Fly   205 VKQIHYSGKLWNTLIGIQSYG-----VSERCIYNKIAHYIDWI 242
            ....||.|..:  |.||.|:|     |....:|.:::.||:|:
Human   436 PHATHYRGTWY--LTGIVSWGQGCATVGHFGVYTRVSQYIEWL 476

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34437NP_001097955.1 Tryp_SPc 39..242 CDD:214473 67/236 (28%)
Tryp_SPc 39..242 CDD:304450 67/236 (28%)
F7XP_011535776.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.