DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34437 and F2

DIOPT Version :9

Sequence 1:NP_001097955.1 Gene:CG34437 / 5740179 FlyBaseID:FBgn0085466 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_000497.1 Gene:F2 / 2147 HGNCID:3535 Length:622 Species:Homo sapiens


Alignment Length:249 Identity:62/249 - (24%)
Similarity:111/249 - (44%) Gaps:48/249 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 TPW--MAFIASPTK-NCSGTLINKQYVITTASCV--------FDQSESTVFLGRFDNIPQNRNRY 93
            :||  |.|..||.: .|..:||:.::|:|.|.|:        |.:::..|.:|:.......||..
Human   375 SPWQVMLFRKSPQELLCGASLISDRWVLTAAHCLLYPPWDKNFTENDLLVRIGKHSRTRYERNIE 439

  Fly    94 VKHSVQSVYTHKLYN-KQTFEHDIALLLLDDPVTFKMSIQPICI-------------WLGEITNL 144
            ....::.:|.|..|| ::..:.||||:.|..||.|...|.|:|:             :.|.:|..
Human   440 KISMLEKIYIHPRYNWRENLDRDIALMKLKKPVAFSDYIHPVCLPDRETAASLLQAGYKGRVTGW 504

  Fly   145 NHLESNRW----GLSEKMIFQRINTVKILKIKKCRDSFGITLKKSQICAGF-----QNGNICT-E 199
            .:|:.. |    |..:..:.|.:| :.|::...|:||..|.:..:..|||:     :.|:.|. :
Human   505 GNLKET-WTANVGKGQPSVLQVVN-LPIVERPVCKDSTRIRITDNMFCAGYKPDEGKRGDACEGD 567

  Fly   200 TGSSLVKQIHYSGKLWNTLIGIQSYGVSERC-------IYNKIAHYIDWIVGVV 246
            :|...|.:..::.:.:.  :||.|:|  |.|       .|..:.....||..|:
Human   568 SGGPFVMKSPFNNRWYQ--MGIVSWG--EGCDRDGKYGFYTHVFRLKKWIQKVI 617

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34437NP_001097955.1 Tryp_SPc 39..242 CDD:214473 59/243 (24%)
Tryp_SPc 39..242 CDD:304450 59/243 (24%)
F2NP_000497.1 GLA 25..88 CDD:214503
KR 105..186 CDD:238056
KR 211..293 CDD:214527
Thrombin_light 317..363 CDD:286482
Tryp_SPc 363..613 CDD:214473 59/243 (24%)
Tryp_SPc 364..616 CDD:238113 61/246 (25%)
High affinity receptor-binding region which is also known as the TP508 peptide 551..573 5/21 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.