DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34437 and St14

DIOPT Version :9

Sequence 1:NP_001097955.1 Gene:CG34437 / 5740179 FlyBaseID:FBgn0085466 Length:266 Species:Drosophila melanogaster
Sequence 2:XP_036010597.1 Gene:St14 / 19143 MGIID:1338881 Length:875 Species:Mus musculus


Alignment Length:236 Identity:53/236 - (22%)
Similarity:97/236 - (41%) Gaps:43/236 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 ETPWMAFIASPTKN--CSGTLINKQYVITTASCVFDQSES--------TVFLGRFDNIPQNRNRY 93
            |.||...:.:..:.  |..:||:..::::.|.|..|....        |.|||..|...::.:..
Mouse   645 EWPWQVSLHALGQGHLCGASLISPDWLVSAAHCFQDDKNFKYSDYTMWTAFLGLLDQSKRSASGV 709

  Fly    94 VKHSVQSVYTHKLYNKQTFEHDIALLLLDDPVTFKMSIQPIC-------------IWLGEITNLN 145
            .:..::.:.||..:|..||::|||||.|:..|.:...::|||             ||   :|...
Mouse   710 QELKLKRIITHPSFNDFTFDYDIALLELEKSVEYSTVVRPICLPDATHVFPAGKAIW---VTGWG 771

  Fly   146 HLESNRWGLSEKMIFQRINTVKILKIKKCRDSFGITLKKSQICAGFQNGNI--CTETGSSLVKQI 208
            |.:....|   .:|.|: ..::::....|.|.....:....:|.||.:|.:  |.......:...
Mouse   772 HTKEGGTG---ALILQK-GEIRVINQTTCEDLMPQQITPRMMCVGFLSGGVDSCQGDSGGPLSSA 832

  Fly   209 HYSGKLWNTLIGIQSYGVSERC-------IYNKIAHYIDWI 242
            ...|:::..  |:.|:|  |.|       :|.::....|||
Mouse   833 EKDGRMFQA--GVVSWG--EGCAQRNKPGVYTRLPVVRDWI 869

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34437NP_001097955.1 Tryp_SPc 39..242 CDD:214473 51/234 (22%)
Tryp_SPc 39..242 CDD:304450 51/234 (22%)
St14XP_036010597.1 SEA 108..198 CDD:396113
CUB 247..352 CDD:238001
CUB 360..464 CDD:238001
LDLa 474..506 CDD:238060
LDLa 512..543 CDD:238060
LDLa 545..579 CDD:238060
LDLa 587..622 CDD:238060
Tryp_SPc 635..872 CDD:238113 53/236 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.