DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34437 and CTSG

DIOPT Version :9

Sequence 1:NP_001097955.1 Gene:CG34437 / 5740179 FlyBaseID:FBgn0085466 Length:266 Species:Drosophila melanogaster
Sequence 2:XP_011534801.1 Gene:CTSG / 1511 HGNCID:2532 Length:269 Species:Homo sapiens


Alignment Length:280 Identity:69/280 - (24%)
Similarity:104/280 - (37%) Gaps:74/280 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LCFLFTLVL---AHQGSA-------YFLDFECV---NHKPHQDVFKETPWMAF--IASPT--KNC 53
            |..|...:|   |..|||       .||..|.:   ..:||     ..|:||:  |.||.  ..|
Human     4 LLLLLAFLLPTGAEAGSASIELSAKCFLPGEIIGGRESRPH-----SRPYMAYLQIQSPAGQSRC 63

  Fly    54 SGTLINKQYVITTASCVFDQSESTVFLGRFDNIPQNRNRYVKHSVQSVYTHKLYNKQTFEHDIAL 118
            .|.|:.:.:|:|.|.|.  .|...|.||. .||.:..|.....:.:....|..||::|.::||.|
Human    64 GGFLVREDFVLTAAHCW--GSNINVTLGA-HNIQRRENTQQHITARRAIRHPQYNQRTIQNDIML 125

  Fly   119 LLLDDPVTFKMSIQPI--------------CIWLGEITNLNHLESNRWGLSEKMIFQRINT---- 165
            |.|...|....::.|:              |...|            ||    .:..|..|    
Human   126 LQLSRRVRRNRNVNPVALPRAQEGLRPGTLCTVAG------------WG----RVSMRRGTDTLR 174

  Fly   166 ---VKILKIKKCRDSFGITLKKSQICAGFQNGNICTETGSSLVKQIHYSGKLW--NTLIGIQSYG 225
               :::.:.::|...||....:.|||.|.:........|.|       .|.|.  |...||.|||
Human   175 EVQLRVQRDRQCLRIFGSYDPRRQICVGDRRERKAAFKGDS-------GGPLLCNNVAHGIVSYG 232

  Fly   226 VSERC---IYNKIAHYIDWI 242
            .|...   ::.:::.::.||
Human   233 KSSGVPPEVFTRVSSFLPWI 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34437NP_001097955.1 Tryp_SPc 39..242 CDD:214473 55/232 (24%)
Tryp_SPc 39..242 CDD:304450 55/232 (24%)
CTSGXP_011534801.1 Tryp_SPc 34..252 CDD:214473 58/248 (23%)
Tryp_SPc 35..255 CDD:238113 59/249 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.