DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34437 and CTRL

DIOPT Version :9

Sequence 1:NP_001097955.1 Gene:CG34437 / 5740179 FlyBaseID:FBgn0085466 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_001898.1 Gene:CTRL / 1506 HGNCID:2524 Length:264 Species:Homo sapiens


Alignment Length:283 Identity:71/283 - (25%)
Similarity:112/283 - (39%) Gaps:65/283 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LCFLFTLVLAHQGSAYFLDFECVNHKP-----------HQDVFKETPWMAFI--ASPTKNCSGTL 57
            |....||.|...||::......:  ||           ...|....||...:  :|....|.|:|
Human     2 LLLSLTLSLVLLGSSWGCGIPAI--KPALSFSQRIVNGENAVLGSWPWQVSLQDSSGFHFCGGSL 64

  Fly    58 INKQYVITTASCVFDQSESTVFLGRFDNIPQNRNRYVKHSVQSVYTHKLYNKQTFEHDIALLLLD 122
            |::.:|:|.|.|........|.||.:|. ..|.......||....||..:|..|..:|:.||.|.
Human    65 ISQSWVVTAAHCNVSPGRHFVVLGEYDR-SSNAEPLQVLSVSRAITHPSWNSTTMNNDVTLLKLA 128

  Fly   123 DPVTFKMSIQPICI-----------------W-----LGEITNLNHLESNRWGLSEKMIFQRINT 165
            .|..:...|.|:|:                 |     :|.:|.. ||             |:: .
Human   129 SPAQYTTRISPVCLASSNEALTEGLTCVTTGWGRLSGVGNVTPA-HL-------------QQV-A 178

  Fly   166 VKILKIKKCRDSFGITLKKSQICAGFQNGNICT-ETGSSLVKQIHYSGKLWNTLIGIQSYGVSER 229
            :.::.:.:||..:|.::..|.||||....:.|. ::|..||.|   .|..| .||||.|:| ::.
Human   179 LPLVTVNQCRQYWGSSITDSMICAGGAGASSCQGDSGGPLVCQ---KGNTW-VLIGIVSWG-TKN 238

  Fly   230 C------IYNKIAHYIDWIVGVV 246
            |      :|.:::.:..||..|:
Human   239 CNVRAPAVYTRVSKFSTWINQVI 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34437NP_001097955.1 Tryp_SPc 39..242 CDD:214473 59/233 (25%)
Tryp_SPc 39..242 CDD:304450 59/233 (25%)
CTRLNP_001898.1 Tryp_SPc 34..260 CDD:238113 62/246 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.