DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34437 and Gzme

DIOPT Version :9

Sequence 1:NP_001097955.1 Gene:CG34437 / 5740179 FlyBaseID:FBgn0085466 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_034503.2 Gene:Gzme / 14942 MGIID:109265 Length:248 Species:Mus musculus


Alignment Length:247 Identity:55/247 - (22%)
Similarity:90/247 - (36%) Gaps:68/247 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 KPHQDVFKETPWMAFIAS-----PTKNCSGTLINKQYVITTASCVFDQSESTVFLGRFDNIPQNR 90
            |||     ..|:|||:.|     ..:.|.|.|:...:|:|.|.|  .....||.||. .||....
Mouse    28 KPH-----SRPYMAFVKSVDIEGNRRYCGGFLVQDDFVLTAAHC--RNRTMTVTLGA-HNIKAKE 84

  Fly    91 NRYVKHSVQSVYTHKLYNKQTFEHDIALLLLDDPVTFKMSIQP--------------ICIWLGEI 141
            .......|.....|..||...|..||.||.|:.......:::|              :|...|  
Mouse    85 ETQQIIPVAKAIPHPDYNATAFFSDIMLLKLESKAKRTKAVRPLKLPRPNARVKPGDVCSVAG-- 147

  Fly   142 TNLNHLESNRWG---LSEKMIFQRINTVKIL--KIKKCRDSFGITLKKSQICAG--------FQN 193
                      ||   :::.....|:...:::  :.::|:..|....:.::||||        |:.
Mouse   148 ----------WGSRSINDTKASARLREAQLVIQEDEECKKRFRHYTETTEICAGDLKKIKTPFKG 202

  Fly   194 GNICTETGSSLVKQIHYSGKLWNTLIGIQSYGVSERC---IYNKIAHYIDWI 242
                 ::|..||..        |...|:.:|..:...   ::.||.|::.||
Mouse   203 -----DSGGPLVCD--------NKAYGLLAYAKNRTISSGVFTKIVHFLPWI 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34437NP_001097955.1 Tryp_SPc 39..242 CDD:214473 50/237 (21%)
Tryp_SPc 39..242 CDD:304450 50/237 (21%)
GzmeNP_034503.2 Tryp_SPc 20..241 CDD:214473 53/245 (22%)
Tryp_SPc 21..244 CDD:238113 55/247 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.