DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34437 and Tmprss3

DIOPT Version :9

Sequence 1:NP_001097955.1 Gene:CG34437 / 5740179 FlyBaseID:FBgn0085466 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_001157248.1 Gene:Tmprss3 / 140765 MGIID:2155445 Length:475 Species:Mus musculus


Alignment Length:238 Identity:64/238 - (26%)
Similarity:106/238 - (44%) Gaps:59/238 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 PWMAFIASPTKN-CSGTLINKQYVITTASCVFD---QSESTVFLG---RFDN-IPQNRNRYVKHS 97
            ||...:.....: |.|::|...:::|.|.||:|   ....||.:|   ..|: :|       .|.
Mouse   251 PWQVSLQFQGYHLCGGSIITPLWIVTAAHCVYDLYHPKSWTVQVGLVSLMDSPVP-------SHL 308

  Fly    98 VQSVYTHKLYNKQTFEHDIALLLLDDPVTFKMSIQPICI-------------WLGEITNLNHLES 149
            |:.:..|..|..:...:||||:.|.:|:||..:|||||:             |           :
Mouse   309 VEKIIYHSKYKPKRLGNDIALMKLSEPLTFDETIQPICLPNSEENFPDGKLCW-----------T 362

  Fly   150 NRWGLSE-----KMIFQRINTVKILKIKKC--RDSFGITLKKSQICAGFQNGNI--CT-ETGSSL 204
            :.||.:|     ..:.... .|.::..|.|  ||.:|..:..|.:|||:..|.:  |. ::|..|
Mouse   363 SGWGATEDGGDASPVLNHA-AVPLISNKICNHRDVYGGIISPSMLCAGYLKGGVDSCQGDSGGPL 426

  Fly   205 VKQIHYSGKLWNTLIGIQSYG-----VSERCIYNKIAHYIDWI 242
            |.|   ..:||. |:|..|:|     |::..:|.:|..::|||
Mouse   427 VCQ---ERRLWK-LVGATSFGIGCAEVNKPGVYTRITSFLDWI 465

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34437NP_001097955.1 Tryp_SPc 39..242 CDD:214473 62/236 (26%)
Tryp_SPc 39..242 CDD:304450 62/236 (26%)
Tmprss3NP_001157248.1 LDLa 96..129 CDD:238060
SRCR_2 134..233 CDD:292133
Tryp_SPc 238..465 CDD:214473 62/236 (26%)
Tryp_SPc 239..468 CDD:238113 64/238 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.