DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34437 and AgaP_AGAP012020

DIOPT Version :9

Sequence 1:NP_001097955.1 Gene:CG34437 / 5740179 FlyBaseID:FBgn0085466 Length:266 Species:Drosophila melanogaster
Sequence 2:XP_320509.4 Gene:AgaP_AGAP012020 / 1280648 VectorBaseID:AGAP012020 Length:753 Species:Anopheles gambiae


Alignment Length:233 Identity:62/233 - (26%)
Similarity:102/233 - (43%) Gaps:47/233 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 TPWMAFIASPTKNCSGTLINKQYVITTASCVFDQSESTVFLGRFD--NIPQNR-NRYVKH-SVQS 100
            |.|:         |.|:||.:.:::|.|.|..|::.:...:.|..  ||..|. |.|.:. .:..
Mosquito    45 TKWL---------CGGSLIRENFILTAAHCTADENNTPPDVARMGDLNIYSNADNEYAQELKIVD 100

  Fly   101 VYTHKLYNKQTFEHDIALLLLDDPVTFKMSIQPICIWLGEITNLNHLESNRW---GLSEKMIFQR 162
            |..|..|...:..:||||:.|:..|:....:.|.|:||.:.....:|.:..|   |.||      
Mosquito   101 VIRHPNYKFTSSYYDIALMKLERNVSVTRYVIPTCLWLEDEIRFPNLMAAGWGRTGFSE------ 159

  Fly   163 INTVKIL-KIK-------KCRDSF---------GITLKKSQICAGFQNGNICT-ETGSSLVKQIH 209
             ||.:|| |::       ||...:         |  |...|:|||.:..:.|. ::|..|...:.
Mosquito   160 -NTSEILMKVQLSPVREDKCLKHYRKGDYKYRNG--LLDHQLCAGDEEMDTCPGDSGGPLHVMLL 221

  Fly   210 YSGKLWNTLIGIQSY----GVSERCIYNKIAHYIDWIV 243
            ...||...|:|:.|:    ||....:|.|::.:.|||:
Mosquito   222 KDKKLVPFLVGVTSFGKICGVPAPGVYIKVSKFGDWII 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34437NP_001097955.1 Tryp_SPc 39..242 CDD:214473 60/230 (26%)
Tryp_SPc 39..242 CDD:304450 60/230 (26%)
AgaP_AGAP012020XP_320509.4 Tryp_SPc 17..258 CDD:214473 60/230 (26%)
Tryp_SPc 18..261 CDD:238113 62/233 (27%)
Tryp_SPc 317..536 CDD:304450
Trypsin 323..533 CDD:278516
Tryp_SPc 641..>732 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.