DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34437 and AgaP_AGAP009211

DIOPT Version :9

Sequence 1:NP_001097955.1 Gene:CG34437 / 5740179 FlyBaseID:FBgn0085466 Length:266 Species:Drosophila melanogaster
Sequence 2:XP_319989.4 Gene:AgaP_AGAP009211 / 1280170 VectorBaseID:AGAP009211 Length:265 Species:Anopheles gambiae


Alignment Length:264 Identity:63/264 - (23%)
Similarity:104/264 - (39%) Gaps:75/264 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 PWMAFIASPTKN---CSGTLINKQYVITTASCV-----------------FDQSESTVFLGR--- 82
            ||||.:.:...:   |.|:||:.::::|.|.||                 :|..||....|.   
Mosquito    21 PWMALLETSVSDDLPCGGSLISDRHILTAAHCVKARKRDCDDRIHFKDDEYDSGESEEADGAEYS 85

  Fly    83 ------FDNIPQNRNRYVKHSVQSVYTHKLYNKQTFEHDIALLLLDDPVTFKMSIQPICIWLGEI 141
                  ...||          ::::.||..|:.::..:|:|::.|..|.....::.|||:.|.| 
Mosquito    86 ASCGPPAQRIP----------IETIVTHPKYSARSKRNDLAIIRLQYPAIIGYNVIPICLPLTE- 139

  Fly   142 TNLNHLESNR--------WGLSE---KMIFQRINTVKILKIKKCR------DSFGITLKKSQICA 189
                .|.:.|        |||:|   :....|...:..|.:..|.      |.. |.|....:||
Mosquito   140 ----QLRAYRPADSFVTGWGLTETGQRSAVLRYAILPALPLPDCAMRIKELDRI-IVLDDGHLCA 199

  Fly   190 GFQNGNI-CTETGSSLVKQIHYSGKLWNTLIGIQSYGVSERC-------IYNKIAHYIDWIV--G 244
            |..|... |.......::.:..|.:.  .|.|:.|:|| :.|       ::..:.|:|||||  .
Mosquito   200 GGNNRTAHCHGDSGGPLQYVSDSTRF--VLQGVVSFGV-KTCGTKIAPGVFANVTHFIDWIVQEA 261

  Fly   245 VVLN 248
            .|||
Mosquito   262 NVLN 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34437NP_001097955.1 Tryp_SPc 39..242 CDD:214473 57/254 (22%)
Tryp_SPc 39..242 CDD:304450 57/254 (22%)
AgaP_AGAP009211XP_319989.4 Tryp_SPc 9..257 CDD:214473 57/254 (22%)
Tryp_SPc 9..257 CDD:238113 57/254 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.