DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34437 and CG43336

DIOPT Version :9

Sequence 1:NP_001097955.1 Gene:CG34437 / 5740179 FlyBaseID:FBgn0085466 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_001247122.1 Gene:CG43336 / 12798414 FlyBaseID:FBgn0263041 Length:279 Species:Drosophila melanogaster


Alignment Length:281 Identity:80/281 - (28%)
Similarity:126/281 - (44%) Gaps:46/281 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MTAGSLCFLFTLVLAHQGSAYFLDFEC--VNHKPHQDVFK--------ETPWMAFIASPTKN--C 53
            :..|...||..|:    ||..|||..|  ..|.|.....|        .:|||||:.|....  |
  Fly     4 VVVGLTFFLLPLL----GSTQFLDMACGIRAHSPSVPRVKNGTVASLTSSPWMAFLHSTDGRFIC 64

  Fly    54 SGTLINKQYVITTASCVFDQSESTVFLGRFDNIPQNRNRY-----------VKHSVQSVYTHKLY 107
            .|:||..:.|:|.|.|..|::|....||.:|     |..|           ::..|:..:.|:.|
  Fly    65 GGSLITNRLVLTAAHCFLDRTELVARLGEYD-----REEYEMCHDSYCTYRIEAMVERGFRHRHY 124

  Fly   108 NKQTFEHDIALLLLDDPVTFKMSIQPICI-----WLGEITNLNHLESNRWGLSE-KMIFQRINTV 166
            |..|..:|||:|.|...|.:..:|:||||     |...|.:|:.|....||.:| :....::.||
  Fly   125 NPMTMAYDIAILRLYRKVQYTDNIRPICIVIDPRWRKYIDSLDPLTGTGWGKTESEGDSAKLRTV 189

  Fly   167 KILK--IKKCRDSFGITLKKSQICAGFQNGNICT-ETGSSLVKQIHYSGKLWNTLIGIQSYGVSE 228
            .:.:  .:.||....::|..:|.|||.:..|:|. ::|..:...|.|........:||.|: .:.
  Fly   190 DLARKHPEVCRRYATLSLTANQFCAGNERSNLCNGDSGGPVGALIPYGKSKRFVQVGIASF-TNT 253

  Fly   229 RC----IYNKIAHYIDWIVGV 245
            :|    ::..:..|:|||:.|
  Fly   254 QCVMVSVFTDVMSYVDWILAV 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34437NP_001097955.1 Tryp_SPc 39..242 CDD:214473 64/228 (28%)
Tryp_SPc 39..242 CDD:304450 64/228 (28%)
CG43336NP_001247122.1 Tryp_SPc 37..271 CDD:214473 65/239 (27%)
Tryp_SPc 40..271 CDD:238113 64/236 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.