DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34437 and CG43335

DIOPT Version :9

Sequence 1:NP_001097955.1 Gene:CG34437 / 5740179 FlyBaseID:FBgn0085466 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_001247121.1 Gene:CG43335 / 12798413 FlyBaseID:FBgn0263040 Length:281 Species:Drosophila melanogaster


Alignment Length:264 Identity:76/264 - (28%)
Similarity:114/264 - (43%) Gaps:40/264 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 CFLFTLVLAHQ-----GSAYFLDFECVNHKPHQDVFKETPWMAFIASPTKN-CSGTLINKQYVIT 65
            |.:.|:...|:     ||    |.|..:|          ||||::.:.... |:||||..|:|:|
  Fly    29 CGIRTMPSFHRTRIIGGS----DAEITSH----------PWMAYLYNEFHYFCAGTLITNQFVLT 79

  Fly    66 TASCVFDQSESTVFLG-----RFDNIPQNRNRYVKHSVQSVYTHKLYNKQTFEHDIALLLLDDPV 125
            .|.|:......||.||     |.|. ...:.....:||.....||.:......:|||::.|...|
  Fly    80 AAHCIEASKNLTVRLGGSGLTRSDG-SMCQITAEDYSVSMAIKHKYFTPSIMLNDIAMIRLARTV 143

  Fly   126 TFKMSIQPICIWLGEITNL-----NHLESNRWGLSEKMIFQRI---NTVKILKIKKCRDSFGITL 182
            .|...|:||||.|.....|     ..|.:..|||::|.:...:   ..:.::....|...:.:.:
  Fly   144 KFYDHIRPICIILDPAVRLLLEDGMTLMATGWGLADKRMHPHLLQEAPITVMNRNVCSKLYDVAI 208

  Fly   183 KKSQICAGFQNGNICT-ETGSSLVKQIHYSGKLWNTLIGIQSYGVSERC----IYNKIAHYIDWI 242
            .:.|||||.:..|.|. ::|..|...::|.|.|.....||.|:|..| |    ||..::.|..||
  Fly   209 TQGQICAGDKETNTCLGDSGGPLGGVVNYYGDLRFVQYGITSFGDIE-CRSPSIYTDLSTYSGWI 272

  Fly   243 VGVV 246
            ..||
  Fly   273 NMVV 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34437NP_001097955.1 Tryp_SPc 39..242 CDD:214473 64/221 (29%)
Tryp_SPc 39..242 CDD:304450 64/221 (29%)
CG43335NP_001247121.1 Tryp_SPc 41..272 CDD:214473 69/246 (28%)
Tryp_SPc 42..275 CDD:238113 71/248 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.