DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34437 and CG43110

DIOPT Version :9

Sequence 1:NP_001097955.1 Gene:CG34437 / 5740179 FlyBaseID:FBgn0085466 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_001246396.1 Gene:CG43110 / 12798330 FlyBaseID:FBgn0262570 Length:483 Species:Drosophila melanogaster


Alignment Length:266 Identity:80/266 - (30%)
Similarity:126/266 - (47%) Gaps:42/266 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LCFLFTLVLAHQGSAYFLDFECVNHKPHQDVF-------KETPWMAFIASPTK-NCSGTLINKQY 62
            ||.|.:..||:   :.||...| ...|...:.       :...:||.|.:.|. .|.||:|::.:
  Fly    10 LCSLGSCQLAY---SMFLKQPC-GKTPVPKIISGSNASQQSAQYMAGIFNTTHLLCGGTIIHEDF 70

  Fly    63 VITTASCVFDQSESTVF--LGRFD-NIPQNRNRYVKHSVQSVYTHKLYNKQTFEHDIALLLLDDP 124
            |:|.|.|   :|..|:|  ||.:: |.|.::.|.::     ...|..|:..|:.:||||:.|:..
  Fly    71 VLTVAHC---KSTQTLFVRLGAYNINHPTDQIRVIE-----TIAHPQYSNSTYANDIALVKLERS 127

  Fly   125 VTFKMSIQPICIWLGEI--TNLNHLESNRWG----LSEKMIFQRI---NTVKILKIKKCRDSFGI 180
            |.|.::||||||.|...  ..:.:..:..||    ..:..|.|||   .|..::    |....|:
  Fly   128 VIFNLNIQPICIHLDATLGKQIRYYNAFGWGRTRNAEQSDILQRIFVNRTNPMI----CHLYLGM 188

  Fly   181 TLKKSQICAGFQNGNICT-ETGSSLVKQIHYSGKLWNTLIGIQSYGVSERC----IYNKIAHYID 240
            :....||||....|:.|. ::|..|:.:|.|.||.::|..||.|||..| |    :|..::.|..
  Fly   189 SPDPKQICATTDQGDTCAGDSGGPLISKITYQGKNFDTQFGITSYGTRE-CNGVGLYTDVSQYSG 252

  Fly   241 WIVGVV 246
            ||..:|
  Fly   253 WIANIV 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34437NP_001097955.1 Tryp_SPc 39..242 CDD:214473 68/220 (31%)
Tryp_SPc 39..242 CDD:304450 68/220 (31%)
CG43110NP_001246396.1 Tryp_SPc 35..254 CDD:214473 68/231 (29%)
Tryp_SPc 36..257 CDD:238113 70/233 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.