DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34437 and CG43124

DIOPT Version :9

Sequence 1:NP_001097955.1 Gene:CG34437 / 5740179 FlyBaseID:FBgn0085466 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_001247345.1 Gene:CG43124 / 12798282 FlyBaseID:FBgn0262587 Length:245 Species:Drosophila melanogaster


Alignment Length:271 Identity:77/271 - (28%)
Similarity:113/271 - (41%) Gaps:68/271 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LCFLFTLVLAHQGSAYFLDFECVNHKPHQDVFKETPWMAFIASPTK-NCSGTLINKQYVITTASC 69
            ||.   :::.:||||..|:.:||:|....:.....||:|.|.|.:| .|:|.|||..||:|.|||
  Fly     9 LCI---VLMFYQGSAQTLEEDCVDHMERINGSSYAPWLAEILSDSKVICAGALINNLYVLTAASC 70

  Fly    70 VFDQSESTVFLGR--FDNIPQNRNRYVKHSVQSVY---THKLYNKQTFEHDIALLLLDDPVTFKM 129
            ..:..:.||.||.  ||      ..|....|...|   ||...|.   .:::.:..|...|.||.
  Fly    71 FKENEKLTVRLGSGYFD------KSYENFRVTKAYFWMTHFPANN---TNNLCIFRLQTEVEFKT 126

  Fly   130 SIQPICIW-----LGEITNLNHLESNRWGLSEKMIFQRINT-------VKILKIKKCRDSFGITL 182
            .|:|:||.     ||..|.                |:.||.       .|.:|...|:..||...
  Fly   127 HIRPMCITKSPKSLGLATT----------------FEIINEKPKMWYFCKNIKGLFCKYVFGENE 175

  Fly   183 KKSQICAGFQNGNICTETGSS-----LVKQIHYSGKLWNTLIGIQSYGVSERC--IYNKIAHYID 240
            :|.|   ....|:..|||.|:     ||:            .||.||..::..  :|..:..:|:
  Fly   176 EKWQ---SKPTGSPWTETISNGPFKGLVR------------YGILSYRDNKTYDEVYINVMSHIN 225

  Fly   241 WIVGVVLNVDV 251
            ||..:.|.:|:
  Fly   226 WIAQISLEIDI 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34437NP_001097955.1 Tryp_SPc 39..242 CDD:214473 63/227 (28%)
Tryp_SPc 39..242 CDD:304450 63/227 (28%)
CG43124NP_001247345.1 Tryp_SPc 41..>133 CDD:304450 35/100 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.