DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34437 and AgaP_AGAP006486

DIOPT Version :9

Sequence 1:NP_001097955.1 Gene:CG34437 / 5740179 FlyBaseID:FBgn0085466 Length:266 Species:Drosophila melanogaster
Sequence 2:XP_316523.4 Gene:AgaP_AGAP006486 / 1277090 VectorBaseID:AGAP006486 Length:287 Species:Anopheles gambiae


Alignment Length:258 Identity:59/258 - (22%)
Similarity:93/258 - (36%) Gaps:82/258 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 PWMAFIA-------------------SPTKN--CSGTLINKQYVITTASCVFDQSESTVF---LG 81
            |::.|||                   :|..|  |.|.::|:.:|:|.|.||.....:.:|   |.
Mosquito    36 PFLPFIAGGTNAVNGQFPSIVAVGLPAPPNNAFCGGVILNENHVLTAARCVLTPQNTLLFANQLN 100

  Fly    82 RFDNIPQNRNRYVKHSVQSVYTHKLYNKQTFEHDIALLLLDDPVTFKMSIQPI------------ 134
            ....:.|......:..:.:||.|..||..||||:||:|....  .|...:.|:            
Mosquito   101 ILSGMLQLNFGAPRIGITAVYVHPQYNPFTFEHNIAVLRTSS--NFFFPVVPVPNVDFAQFYEEI 163

  Fly   135 ------CIWLGEITNLNHLESNRWGLSEKMIFQRINTVKILKIKKCRDSFGI-----TLKKSQIC 188
                  |..:|            |........|:.....||....|.   |:     .:::|.:|
Mosquito   164 AFDGQPCQVVG------------WNNGTATPVQQFINAPILNRDTCN---GLAVHLGNIRESMVC 213

  Fly   189 AGFQNG--NICTETGSSLVKQIHYSGKLWNTLIGIQSYGVSERC-------IYNKIAHYIDWI 242
            ||..|.  .:|   .|:|...:...|:    |.||.|.|:.  |       :|.:|.:|:.||
Mosquito   214 AGVTNAGPGVC---ASNLGTGLFCEGR----LAGILSTGLG--CGQANNPGVYTQIRYYLPWI 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34437NP_001097955.1 Tryp_SPc 39..242 CDD:214473 57/256 (22%)
Tryp_SPc 39..242 CDD:304450 57/256 (22%)
AgaP_AGAP006486XP_316523.4 Tryp_SPc 41..270 CDD:238113 57/253 (23%)
Tryp_SPc 41..267 CDD:214473 55/251 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.