DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34437 and AgaP_AGAP006385

DIOPT Version :9

Sequence 1:NP_001097955.1 Gene:CG34437 / 5740179 FlyBaseID:FBgn0085466 Length:266 Species:Drosophila melanogaster
Sequence 2:XP_316419.4 Gene:AgaP_AGAP006385 / 1276997 VectorBaseID:AGAP006385 Length:260 Species:Anopheles gambiae


Alignment Length:206 Identity:56/206 - (27%)
Similarity:100/206 - (48%) Gaps:24/206 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 CSGTLINKQYVITTASCVFDQSESTVFLGRFDNIPQNRN--RYVKHSVQSVYTHKLYNKQTFEHD 115
            |.|:|:|:::|:|...||.......|.||..| ...|.|  |.|..|.: .:.|:.||.....:|
Mosquito    57 CGGSLLNEEWVLTAGHCVMLAKSVEVHLGAVD-FSDNTNDGRLVLESTE-FFKHEKYNPLFVAND 119

  Fly   116 IALLLLDDPVTFKMSIQPICIWLG-EITNLNHLESNRWGL--SEKMIFQRIN--TVKILKIKKCR 175
            :||:.|...|.|...:||:.:..| |......:..:.|||  :...:.|.:.  |:|::..|:|:
Mosquito   120 VALVKLPSKVEFSERVQPVRLPTGDEDFAGREVVVSGWGLMVNGGQVAQELQYATLKVIPNKQCQ 184

  Fly   176 DSFG-ITLKKSQICA-GFQNGNICT-ETGSSLVKQIHYSGKLWNTLIGIQSYGVSERC------I 231
            .:|. :.::||.:|| |.:..:.|. ::|..||....      .||:|:.|:|.::.|      .
Mosquito   185 KTFSPLLVRKSTLCAVGEELRSPCNGDSGGPLVLAED------KTLVGVVSFGHAQGCDKGHPAA 243

  Fly   232 YNKIAHYIDWI 242
            :.::..:.||:
Mosquito   244 FARVTAFRDWV 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34437NP_001097955.1 Tryp_SPc 39..242 CDD:214473 55/204 (27%)
Tryp_SPc 39..242 CDD:304450 55/204 (27%)
AgaP_AGAP006385XP_316419.4 Tryp_SPc 27..254 CDD:214473 55/204 (27%)
Tryp_SPc 28..257 CDD:238113 56/206 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.