DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34437 and AgaP_AGAP008808

DIOPT Version :9

Sequence 1:NP_001097955.1 Gene:CG34437 / 5740179 FlyBaseID:FBgn0085466 Length:266 Species:Drosophila melanogaster
Sequence 2:XP_557970.3 Gene:AgaP_AGAP008808 / 1275666 VectorBaseID:AGAP008808 Length:574 Species:Anopheles gambiae


Alignment Length:298 Identity:67/298 - (22%)
Similarity:116/298 - (38%) Gaps:75/298 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LCFLFTLVLAHQGSAYFLDFECVNHKPH--------QDVF----------KETPWMAFI-----A 47
            :|.....||...|..||:...|...:.:        |.||          ...||.|.|     .
Mosquito     3 MCCSLKRVLLLFGFLYFMSRACGQEENYLTCGRRKVQSVFLIHNGVDAKAGHWPWHAAIFHGNGR 67

  Fly    48 SPTKNCSGTLINKQYVITTASCVF------DQSESTVFLGRFDNIPQNRNRYVK-HSVQSVYTHK 105
            .....|.|:::::..::|.:.||:      ..:..:|.:|:..  .:..:.|.: |.||.:..|.
Mosquito    68 QEEYQCGGSILDQNTILTASHCVYTHKSVISAARVSVHVGQIH--LKETSEYTQIHGVQDIILHP 130

  Fly   106 LYNKQTFEHDIALLLLDDPVTFKMSIQPICIWLGEITNLNHLESNR------------WGLSEKM 158
            .:|..:|.:|||||.|...:|....:||:|:|.        ::||:            :||:|..
Mosquito   131 EFNSNSFNNDIALLKLSTNITMTKYVQPVCLWT--------MDSNQEMIVGKNGTIVGFGLNEHD 187

  Fly   159 IFQ------RINTVKILK-IKKCRDSFGITLKKSQICAGFQNG-NICT-ETGSSLVKQIHYSGKL 214
            :..      .:..|..|. ||..|.:||..|.....|...:.| ..|. ::|..:..::   |..
Mosquito   188 VVSDQLKQALVGVVDALTCIKSDRAAFGPVLTSEMFCGKGRTGVGACNGDSGGGMFFEV---GGK 249

  Fly   215 WNTLIGIQSY----GVSERC------IYNKIAHYIDWI 242
            | .:.|:.|:    |.:..|      .|..:|.|::||
Mosquito   250 W-FVRGLVSFTPLRGNTGLCDPLKYTAYTDVAKYLEWI 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34437NP_001097955.1 Tryp_SPc 39..242 CDD:214473 55/245 (22%)
Tryp_SPc 39..242 CDD:304450 55/245 (22%)
AgaP_AGAP008808XP_557970.3 Tryp_SPc 44..288 CDD:238113 57/257 (22%)
Tryp_SPc 46..286 CDD:214473 55/253 (22%)
Tryp_SPc 324..566 CDD:304450
Tryp_SPc 330..566 CDD:214473
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.