DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34437 and AgaP_AGAP008558

DIOPT Version :9

Sequence 1:NP_001097955.1 Gene:CG34437 / 5740179 FlyBaseID:FBgn0085466 Length:266 Species:Drosophila melanogaster
Sequence 2:XP_314667.4 Gene:AgaP_AGAP008558 / 1275424 VectorBaseID:AGAP008558 Length:574 Species:Anopheles gambiae


Alignment Length:239 Identity:63/239 - (26%)
Similarity:107/239 - (44%) Gaps:49/239 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 PWMAFI-----ASPTKNCSGTLINKQYVITTASCV-FDQSESTVFLGRFDNIPQNRNR-YV---- 94
            ||.|.|     .|....|.|.:||:..::|.|.|| .:|...||     |.:.....| |:    
Mosquito    49 PWHAAIFHRIERSFMYQCGGAIINQNTILTAAHCVQLNQGVITV-----DRLSVQVGRTYLYAAE 108

  Fly    95 ----KHSVQSVYTHKLYNKQTFEHDIALLLLDDPVTFKMSIQPICIWLGEITNLNHLESN----- 150
                :|..:.:..|:.|:.....:||||:.|...:.|...:||:|:|....|::..|...     
Mosquito   109 SHTQEHQAERIIVHEEYSAAQVRNDIALIKLATDIRFTEYVQPVCLWDRARTDIGQLIGRVGTVI 173

  Fly   151 RWGLSEKMIFQ-----RINTVKILKIKKC----RDSFGITLKKSQICAGFQNG-NIC-TETGSSL 204
            .:|::|  |.:     |:..:.|:..:.|    |:.||..|.::..||||:|| .:| .::|..:
Mosquito   174 GFGITE--IGEVADRLRVAYMPIVDTQTCLESNRNLFGRVLTRNVFCAGFRNGTTVCGGDSGGGM 236

  Fly   205 VKQIHYSGKLWNTLIGIQSYGVSERCI------YNKIAHYIDWI 242
            ..:|.   ..| .:.||.|:. .:.|.      ::.:|.|:|||
Mosquito   237 YFEIE---NRW-YIRGIVSFS-GQNCQSADFAGFSDVATYLDWI 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34437NP_001097955.1 Tryp_SPc 39..242 CDD:214473 61/237 (26%)
Tryp_SPc 39..242 CDD:304450 61/237 (26%)
AgaP_AGAP008558XP_314667.4 Tryp_SPc 37..277 CDD:238113 63/239 (26%)
Tryp_SPc 37..275 CDD:214473 61/237 (26%)
Tryp_SPc 322..568 CDD:214473
Tryp_SPc 322..568 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.