DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34437 and AgaP_AGAP010546

DIOPT Version :9

Sequence 1:NP_001097955.1 Gene:CG34437 / 5740179 FlyBaseID:FBgn0085466 Length:266 Species:Drosophila melanogaster
Sequence 2:XP_314515.4 Gene:AgaP_AGAP010546 / 1275277 VectorBaseID:AGAP010546 Length:295 Species:Anopheles gambiae


Alignment Length:198 Identity:46/198 - (23%)
Similarity:86/198 - (43%) Gaps:34/198 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 CSGTLINKQYVITTASCVFDQSESTVFLGRF----------DNIPQNRNRYVKHSVQSVYTHKLY 107
            |.|:||.:.:::|.|.|..:..:....:.|.          |..|| :.|.||     |..|:.:
Mosquito    94 CGGSLIWENFILTAAHCAANDEDVPPDVARMGDLNIYSDDDDEFPQ-QLRIVK-----VIRHQQH 152

  Fly   108 NKQTFEHDIALLLLDDPVTFKMSIQPICIWLGEITNLNHLESNRWGLSEKMIFQRINTVKILKI- 171
            ......:|:||:.|:..:|...::.|.|:||.:......|.:..||   :..|....|..:||: 
Mosquito   153 RFSAKYYDVALMQLEKNITVHETVAPACLWLDDEVRFPKLYAAGWG---RTGFGEDKTNILLKVD 214

  Fly   172 ------KKCRDSF-----GIT--LKKSQICAGFQNGNICT-ETGSSLVKQIHYSGKLWNTLIGIQ 222
                  .:|...:     |:.  |....:|||.:..:.|. ::|..|..::.::.|:...|:|:.
Mosquito   215 LTPMNNTQCSKFYTSSERGLRNGLHAHHLCAGDEKMDTCPGDSGGPLHVKLLHNAKMTPFLVGVT 279

  Fly   223 SYG 225
            |:|
Mosquito   280 SFG 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34437NP_001097955.1 Tryp_SPc 39..242 CDD:214473 46/198 (23%)
Tryp_SPc 39..242 CDD:304450 46/198 (23%)
AgaP_AGAP010546XP_314515.4 Tryp_SPc 67..295 CDD:214473 46/198 (23%)
Tryp_SPc 67..295 CDD:238113 46/198 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.