DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34437 and AgaP_AGAP004859

DIOPT Version :9

Sequence 1:NP_001097955.1 Gene:CG34437 / 5740179 FlyBaseID:FBgn0085466 Length:266 Species:Drosophila melanogaster
Sequence 2:XP_314332.2 Gene:AgaP_AGAP004859 / 1275102 VectorBaseID:AGAP004859 Length:264 Species:Anopheles gambiae


Alignment Length:252 Identity:60/252 - (23%)
Similarity:99/252 - (39%) Gaps:68/252 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 QDVFKETPWMAFIA--SPTKN-------CSGTLINKQYVITTASCVFDQSESTVFLGRF----DN 85
            |.:|.:.|..:.|.  ..|::       |.|:.|.:..|:..|.||..:::..:...||    ||
Mosquito    21 QGIFSQNPQTSHIVLLGSTRSDGTREFRCGGSYIGQNIVLAGAHCVTGKNQPALDTVRFGSGTDN 85

  Fly    86 IPQNRNRYVKHSVQSVYTHKLYNKQTFEHDIALLLLD---DPVT---FKMSIQPICI-------- 136
            :  ...|.|.|::     |..|..|...|::|:..||   |.|.   ||    |.||        
Mosquito    86 V--MHFRIVNHTL-----HYRYKPQFEYHNMAVYYLDARPDLVNAGRFK----PACILKPHMKQG 139

  Fly   137 ---WLGEITNLNHLESNRWGLSEKMIFQRINTVKILKIKKCRD--------SFGITLKKSQICAG 190
               .:|:       .||..||:     .:..::.::..:||.:        .||:.|  ...||.
Mosquito   140 IVQMVGD-------SSNGRGLA-----LQSTSLDVVASEKCHEYYNPIPKLRFGVLL--CCFCAM 190

  Fly   191 FQNGNICTETGSS-LVKQIHYSGKLWNTLIGIQSY----GVSERCIYNKIAHYIDWI 242
            ..:...|:...|| |...|:.:||....|||.:|.    ||....::.:...|.:|:
Mosquito   191 NSDTTECSNMHSSPLQLVINRNGKSVPFLIGHKSIGKACGVKSPAVFTRYGSYYEWL 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34437NP_001097955.1 Tryp_SPc 39..242 CDD:214473 57/245 (23%)
Tryp_SPc 39..242 CDD:304450 57/245 (23%)
AgaP_AGAP004859XP_314332.2 Trypsin 41..247 CDD:278516 54/230 (23%)
Tryp_SPc 43..250 CDD:304450 55/230 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.