DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34437 and AgaP_AGAP005065

DIOPT Version :9

Sequence 1:NP_001097955.1 Gene:CG34437 / 5740179 FlyBaseID:FBgn0085466 Length:266 Species:Drosophila melanogaster
Sequence 2:XP_313940.4 Gene:AgaP_AGAP005065 / 1274748 VectorBaseID:AGAP005065 Length:246 Species:Anopheles gambiae


Alignment Length:217 Identity:52/217 - (23%)
Similarity:96/217 - (44%) Gaps:56/217 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 CSGTLINKQYVITTASCVFDQSESTVFLGRFDNIPQNRNRYVKHS-------------VQSVYTH 104
            |.|::|..::|:|.|.||.|..   |.|..|        ::..|:             |::||.|
Mosquito    54 CGGSIIGDRHVLTAAHCVMDDD---VLLPAF--------KFGVHAGSAHLNAGGKLFKVRAVYPH 107

  Fly   105 KLYNKQTFEHDIALLLLDDPVTFKMSIQPICIWLGEITNLNHLESNRWG-------LSEKMIFQR 162
            :.|.  .|:||||::.:.:|..|...||||.:...|:.....:..:.:|       :|..:::  
Mosquito   108 EGYG--NFQHDIAVMEMKEPFAFDKYIQPIELMDEEVPLGGEVVISGYGRVGSNGPVSPALLY-- 168

  Fly   163 INTVKILKIKKCRD-SFGITLKKSQICAGFQNGNICTETGSSLVKQIHYSGKLWNTLIGIQSYGV 226
             .::.:::.:.|.. |.|:.....:...|..||    ::|...|    |.||    |.|:.:: :
Mosquito   169 -TSMFVVEDENCNSISEGLMCIDKEGSYGACNG----DSGGPAV----YDGK----LAGVANF-I 219

  Fly   227 SERC------IYNKIAHYIDWI 242
            .::|      .|.|::.|:|||
Mosquito   220 IDQCGGNFADGYAKVSFYLDWI 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34437NP_001097955.1 Tryp_SPc 39..242 CDD:214473 50/215 (23%)
Tryp_SPc 39..242 CDD:304450 50/215 (23%)
AgaP_AGAP005065XP_313940.4 Tryp_SPc 28..241 CDD:214473 50/215 (23%)
Tryp_SPc 29..243 CDD:238113 52/217 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.