DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34437 and CLIPB2

DIOPT Version :9

Sequence 1:NP_001097955.1 Gene:CG34437 / 5740179 FlyBaseID:FBgn0085466 Length:266 Species:Drosophila melanogaster
Sequence 2:XP_312956.3 Gene:CLIPB2 / 1273920 VectorBaseID:AGAP003246 Length:355 Species:Anopheles gambiae


Alignment Length:254 Identity:75/254 - (29%)
Similarity:108/254 - (42%) Gaps:64/254 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 KETPWMAFI--ASPTK----NCSGTLINKQYVITTASCVFDQS------ESTVFLGRFDNIPQN- 89
            :|.||.|.|  ..|..    :|.|.|||.:|::|.|.||  ||      .:.|.||.:|....| 
Mosquito   112 EEFPWTALIEYRKPGNQYDFHCGGALINARYILTAAHCV--QSLPRGWQLNGVRLGEWDLSTAND 174

  Fly    90 ------RNRYVKHSVQSVYTHKLYNKQTFEH--DIALLLLDDPVTFKMSIQPICIWLGEITNLNH 146
                  ....:...::|...|..|:.....|  ||||:.|...|.....|:|||:.|.|    ..
Mosquito   175 CSDGICSAGPIDLEIESFVAHAGYDAADTAHTNDIALIRLRQDVASSEMIRPICLPLTE----PQ 235

  Fly   147 LESNR---------WGLSEKMIFQRINTVKILKIK-------KCRDSF---GITLKKSQICA-GF 191
            ...||         ||.:|......    :.||::       :||..:   .|.||.||:|| |.
Mosquito   236 RSRNRVGTVSFAAGWGKTESASASE----RKLKVELTVQDPSRCRQIYRGINIALKASQMCAGGL 296

  Fly   192 QNGNICT-ETGSSLVKQIHYSGKLWNTLIGIQSYGVSERC-------IYNKIAHYIDWI 242
            |..:.|| ::|..|:.:   |...| .|||:.|:|:| :|       :|..:..|:|||
Mosquito   297 QGKDTCTGDSGGPLMAK---SAGAW-YLIGVVSFGLS-KCGTAGYPGVYTNVVEYLDWI 350

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34437NP_001097955.1 Tryp_SPc 39..242 CDD:214473 73/251 (29%)
Tryp_SPc 39..242 CDD:304450 73/251 (29%)
CLIPB2XP_312956.3 CLIP 26..78 CDD:288855
Tryp_SPc 102..350 CDD:214473 73/252 (29%)
Tryp_SPc 103..353 CDD:238113 75/254 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.