DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34437 and CLIPB8

DIOPT Version :9

Sequence 1:NP_001097955.1 Gene:CG34437 / 5740179 FlyBaseID:FBgn0085466 Length:266 Species:Drosophila melanogaster
Sequence 2:XP_312743.1 Gene:CLIPB8 / 1273740 VectorBaseID:AGAP003057 Length:405 Species:Anopheles gambiae


Alignment Length:260 Identity:68/260 - (26%)
Similarity:115/260 - (44%) Gaps:63/260 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 ETPWMAFIA------SPTKNCSGTLINKQYVITTASCV----FDQSESTVFLGRFD--NIPQNRN 91
            |.||||.:.      :.|:.|.|.||::.||||.|.||    |.|::..:...|..  ||..|.:
Mosquito   147 EFPWMAMLLYERDNNALTQGCGGALISRTYVITAAHCVTGKNFQQTKGRLKFVRLREYNIHTNPD 211

  Fly    92 RYVKHSV------------QSVYTHKLYNKQTF--EHDIALLLLDDPVTFKMSIQPICI----WL 138
            ...::.:            |:|..|..|:.::.  :|||||:.::....|...::.||:    :.
Mosquito   212 CVYENDLKDCSDDMIDLVPQAVIPHPEYDSESSNQQHDIALIRIEQTPPFTDFLRSICLPEQNFE 276

  Fly   139 GEITNLNHLESNRWGLSEKMIFQR------INTVKI------LKIKKCRDSF---GITLKKSQIC 188
            ...|....|..:.||.::  ||:.      ::.:|:      ::.:||..:|   ...|...|:|
Mosquito   277 SSATPGKKLSVSGWGRTD--IFKDNLGPDVLSPIKLKLSLPYVEREKCSKTFRPWSFALGPGQMC 339

  Fly   189 AGFQNG-NICT-ETGSSLVKQIHYSGK--LWNTLIGIQSYGVSERC-------IYNKIAHYIDWI 242
            ||.:.. :.|. ::||.|:.   |..|  :| .:.||.|.|| ..|       :|..:.||:.||
Mosquito   340 AGGERAKDTCAGDSGSPLMS---YDMKRAIW-YITGIVSLGV-RGCGVEGLPGVYTNVHHYLPWI 399

  Fly   243  242
            Mosquito   400  399

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34437NP_001097955.1 Tryp_SPc 39..242 CDD:214473 66/258 (26%)
Tryp_SPc 39..242 CDD:304450 66/258 (26%)
CLIPB8XP_312743.1 CLIP 41..95 CDD:288855
Tryp_SPc 136..399 CDD:214473 66/258 (26%)
Tryp_SPc 139..400 CDD:238113 68/260 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.