DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34437 and CLIPD4

DIOPT Version :9

Sequence 1:NP_001097955.1 Gene:CG34437 / 5740179 FlyBaseID:FBgn0085466 Length:266 Species:Drosophila melanogaster
Sequence 2:XP_312102.4 Gene:CLIPD4 / 1273150 VectorBaseID:AGAP002811 Length:385 Species:Anopheles gambiae


Alignment Length:264 Identity:66/264 - (25%)
Similarity:110/264 - (41%) Gaps:77/264 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 PWMAFIASPTK------NCSGTLINKQYVITTASCVF------------DQSESTVFLGRFDNIP 87
            ||||.:.....      .|.|:||..::|:|.|.|:.            :|:||.     ..::|
Mosquito   139 PWMALVGYEEAFGDVDFRCGGSLITDRHVLTAAHCILSSLLVWMQHDMDNQTESA-----HVDVP 198

  Fly    88 QNRNRYVK-HSVQSVYTHKLYNKQTFEHDIALLLLDDPVTFKMSIQPIC------IWLGEITNLN 145
            ..:.|... :.|:|..:|..|:......|:|:|.|.:.|.|...|:|||      :...:.|..|
Mosquito   199 VYKVRSTSINFVKSYVSHPSYDTFDGHSDVAILFLTETVEFNARIKPICLPTIEPVRSADFTGYN 263

  Fly   146 HLESNRWGLS-----EKMIFQRINTVKILKIKKCRDSFGITLKK------------SQICAGFQN 193
            ...:. ||.:     |..:.|.:. :.||:.::|...:    ||            :.:||||..
Mosquito   264 PFIAG-WGRTKETGIEAKVLQELQ-IPILENEECSQLY----KKIRKLYSTKQFDDAVLCAGFLE 322

  Fly   194 G--NICT-ETGSSLV------KQIHYSGKLWNTLIGIQSYGVSERC-------IYNKIAHYIDWI 242
            |  :.|. ::|..|:      |:.||      ..|||.||||.  |       :|.::..::||:
Mosquito   323 GGKDSCQGDSGGPLMLPYLVNKKFHY------FQIGIVSYGVG--CARAELPGVYTRVVTFVDWL 379

  Fly   243 VGVV 246
            ||.:
Mosquito   380 VGQI 383

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34437NP_001097955.1 Tryp_SPc 39..242 CDD:214473 63/258 (24%)
Tryp_SPc 39..242 CDD:304450 63/258 (24%)
CLIPD4XP_312102.4 Tryp_SPc 126..378 CDD:214473 62/257 (24%)
Tryp_SPc 127..379 CDD:238113 63/258 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.