DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34437 and CLIPD6

DIOPT Version :9

Sequence 1:NP_001097955.1 Gene:CG34437 / 5740179 FlyBaseID:FBgn0085466 Length:266 Species:Drosophila melanogaster
Sequence 2:XP_312099.2 Gene:CLIPD6 / 1273147 VectorBaseID:AGAP002813 Length:484 Species:Anopheles gambiae


Alignment Length:238 Identity:64/238 - (26%)
Similarity:111/238 - (46%) Gaps:42/238 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 PWMAFIASPTKN--------CSGTLINKQYVITTASCVFDQSESTVFLGRFDNIPQNRNRYVKHS 97
            ||||.:.  .||        |.|:||.|::|:|.|.|: .:..|:|.||..|.......:::...
Mosquito   245 PWMALVG--YKNTLGEVSFKCGGSLITKRHVLTAAHCI-RRDLSSVRLGEHDTSTDAETKHIDVP 306

  Fly    98 VQSVYTHKLYNKQTFEHDIALLLLDDPVTFKMSIQPICIWLGE-ITNLNHLESN----RWGLSEK 157
            |....:|..|:|:....|:|:|.::..|.|..:|:|||:.|.| |.:.|.:...    .||.:::
Mosquito   307 VVRYESHPSYDKKDGHTDLAVLYMEFEVQFSDAIKPICLPLSETIRSKNFIGYTPFVAGWGRTQE 371

  Fly   158 -----MIFQRINTVKILKIKKCR---DSFGITLKKSQ-----ICAGFQNG--NICT-ETGSSLVK 206
                 .:.|.:. :.|:...:||   |..|....:.|     :|||...|  :.|. ::|..|:.
Mosquito   372 GGKSANVLQELQ-IPIIANDECRTLYDKIGKVFSQKQFDNAVMCAGVIEGGKDSCQGDSGGPLML 435

  Fly   207 QIHYSGKLWNTLIGIQSYGVSERC-------IYNKIAHYIDWI 242
            ...:..:.:...:||.|||:.  |       :|.::|.::|||
Mosquito   436 PQRFGTEFYYYQVGIVSYGIG--CARAEVPGVYTRVASFVDWI 476

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34437NP_001097955.1 Tryp_SPc 39..242 CDD:214473 62/236 (26%)
Tryp_SPc 39..242 CDD:304450 62/236 (26%)
CLIPD6XP_312099.2 CLIP 25..80 CDD:288855
CLIP 114..166 CDD:288855
Tryp_SPc 232..476 CDD:214473 62/236 (26%)
Tryp_SPc 233..479 CDD:238113 64/238 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.