DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34437 and AgaP_AGAP010730

DIOPT Version :9

Sequence 1:NP_001097955.1 Gene:CG34437 / 5740179 FlyBaseID:FBgn0085466 Length:266 Species:Drosophila melanogaster
Sequence 2:XP_311444.4 Gene:AgaP_AGAP010730 / 1272531 VectorBaseID:AGAP010730 Length:256 Species:Anopheles gambiae


Alignment Length:261 Identity:66/261 - (25%)
Similarity:108/261 - (41%) Gaps:65/261 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 FKETPWMAFIASPTKN--------CSGTLINKQYVITTASCVFDQSESTVFLGRFDNIPQNRNRY 93
            :.|.||:.:|.:..|.        |.||||:.:.|:|||.....:::.....|.:| |...:..:
Mosquito     5 YAEYPWVVYILALKKQEANSGDFVCGGTLIHSRLVVTTAHNTDGKTDLVARFGEWD-ISTTKEPF 68

  Fly    94 VKH--------SVQSVYTHKLYNKQTFEHDIALLLLDDPVTFKMSIQPICI------WLGEITNL 144
            .:.        .|..|..|..|.....::|||||:|.:.|.:...|:|||:      ::|:    
Mosquito    69 PQQCLFPHQDIDVAEVIKHPQYVFNPIQNDIALLVLAENVQYAAHIRPICLPQPTDEFVGQ---- 129

  Fly   145 NHLESNRWG--------LSEKM---IFQRINTVKILKIKKCRDSFGITLKKSQICAGFQNGNICT 198
             ...||.||        :.:|:   :..|.|..::|:.......:  ||::..:|||   |.:..
Mosquito   130 -RCVSNGWGKERGVYANVMKKLTLPVIGRANCTRMLRYAGLGPFY--TLREGFLCAG---GEVAV 188

  Fly   199 ET-----GSSLVKQIHYSGKLWNTLIGIQSYGVSERC-------IYNKIAHYIDW----IVGVVL 247
            :.     ||.|..|.. ||..  .|.||.|:|:.  |       :|..:..|:.|    ||...|
Mosquito   189 DMCKGDGGSPLACQTE-SGTY--VLAGIVSWGIG--CGGFNTPGVYVAVNRYVQWLNEHIVDQAL 248

  Fly   248 N 248
            |
Mosquito   249 N 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34437NP_001097955.1 Tryp_SPc 39..242 CDD:214473 62/251 (25%)
Tryp_SPc 39..242 CDD:304450 62/251 (25%)
AgaP_AGAP010730XP_311444.4 Tryp_SPc 7..242 CDD:238113 62/250 (25%)
Tryp_SPc 7..238 CDD:214473 61/246 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.