DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34437 and CLIPC5

DIOPT Version :9

Sequence 1:NP_001097955.1 Gene:CG34437 / 5740179 FlyBaseID:FBgn0085466 Length:266 Species:Drosophila melanogaster
Sequence 2:XP_310507.4 Gene:CLIPC5 / 1271651 VectorBaseID:AGAP000571 Length:374 Species:Anopheles gambiae


Alignment Length:235 Identity:62/235 - (26%)
Similarity:106/235 - (45%) Gaps:64/235 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 CSGTLINKQYVITTASCVFDQSESTVF--LGRFD----NIP---QNRNRYVKHSVQSVYTHKLY- 107
            |..:||..::::|.|.|:.......|.  :|..|    .:|   |:|      |::::..|..| 
Mosquito   148 CGSSLITVRFLLTAAHCIRTPHGMPVVARMGTIDLLSPPVPADVQDR------SIKNIIVHPQYR 206

  Fly   108 NKQTFEHDIALLLLDDPVTFKMSIQPICIWLGEITNLNH------LESNRWGLSEK------MIF 160
            ||.   .|||||.:.||....:.:||||:    .|:.:.      |:...||.:|:      ::.
Mosquito   207 NKY---DDIALLEVTDPFQMDVVLQPICL----RTDTDEFGPDVVLQVAGWGQTEESTSSAGLLR 264

  Fly   161 QRINTVKILKIKKC-RDSFGITLKK------SQICA-GFQ-------NGNICT-ETGSSLVKQIH 209
            ..::||   .:.:| |...|..|.|      ||.|| ||:       ..:.|. ::|..|   .|
Mosquito   265 ANLSTV---PVAECDRTYAGAMLAKVKSIRPSQYCARGFRAPGEDNWYSDSCEGDSGGPL---YH 323

  Fly   210 YSGKLWNT---LIGIQSYGV----SERCIYNKIAHYIDWI 242
            ..|:..::   |:|:.|:|:    |...:|.::|:|:|||
Mosquito   324 VEGEEGSSKYYLVGVTSFGLGCGSSTPSVYTRVAYYLDWI 363

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34437NP_001097955.1 Tryp_SPc 39..242 CDD:214473 60/233 (26%)
Tryp_SPc 39..242 CDD:304450 60/233 (26%)
CLIPC5XP_310507.4 CLIP 30..77 CDD:197829
Tryp_SPc 109..363 CDD:214473 60/233 (26%)
Tryp_SPc 110..366 CDD:238113 62/235 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.