DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34437 and CLIPC10

DIOPT Version :9

Sequence 1:NP_001097955.1 Gene:CG34437 / 5740179 FlyBaseID:FBgn0085466 Length:266 Species:Drosophila melanogaster
Sequence 2:XP_310506.4 Gene:CLIPC10 / 1271650 VectorBaseID:AGAP000572 Length:380 Species:Anopheles gambiae


Alignment Length:267 Identity:64/267 - (23%)
Similarity:107/267 - (40%) Gaps:78/267 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 FKETPWMAFIASPTKN-----------CSGTLINKQYVITTASCVFDQSESTVF--LGRFDNIP- 87
            |.|.|:||.:.....|           |..:||:.::::|.|.|:   .|..||  ||..:..| 
Mosquito   131 FGEFPYMAALGYGAPNGTEAGLPSLFRCGASLISSRFLLTAAHCL---RERPVFARLGVLELQPA 192

  Fly    88 QNRNRYVKHSVQSVYTHKLYNKQTFEHDIALLLLDDPVTFKMS-IQPICIWL----GEITNL--N 145
            :..:..:..:::....|..|:..|:::|||||.|.:|||.... ::|:|::.    |.:..|  .
Mosquito   193 RTVDEPLDIAIRQATPHPDYHAVTYQNDIALLELAEPVTGDWPFVEPVCLYTNATGGGLEALAGQ 257

  Fly   146 HLESNRWGLSEKMIFQRINTVKILKIKKCRDSFGITLKKSQICA-----------GFQNGNICT- 198
            .|....||..     |..:|....::.|.    .::|.:...||           |...|.:|. 
Mosquito   258 PLSVQGWGTQ-----QPGDTEPAARLMKA----NVSLVERDACAASIPRTRRNPTGLHPGQLCAL 313

  Fly   199 ---------------ETGSSLVKQI---HYSGKLWNTLIGIQSYGVSERC------IYNKIAHYI 239
                           ::|..|...:   ||       |:||.|.|.|  |      ||.::|.|:
Mosquito   314 GRNEQNETVADTCPGDSGGPLALNVDGRHY-------LVGITSSGYS--CGSPIPGIYTEVARYL 369

  Fly   240 DWIVGVV 246
            ||:..:|
Mosquito   370 DWVESIV 376

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34437NP_001097955.1 Tryp_SPc 39..242 CDD:214473 61/259 (24%)
Tryp_SPc 39..242 CDD:304450 61/259 (24%)
CLIPC10XP_310506.4 CLIP 45..89 CDD:197829
Tryp_SPc 122..372 CDD:214473 62/261 (24%)
Tryp_SPc 123..375 CDD:238113 63/264 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.